SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|344210715|ref|YP_004795035.1| from Haloarcula hispanica ATCC 33960

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|344210715|ref|YP_004795035.1|
Domain Number 1 Region: 80-191
Classification Level Classification E-value
Superfamily V-type ATPase subunit E-like 9.81e-21
Family V-type ATPase subunit E 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|344210715|ref|YP_004795035.1|
Sequence length 194
Comment A-type ATP synthase subunit E [Haloarcula hispanica ATCC 33960]
Sequence
MSLQTVVEDIRDEARARAQEISDAADERAEEIIADAEADAEQIHEEREAEVERTIEQERE
QRLSSAKLEAKQARLNARRDILEDVHGDVEDALAALEGDRREELTRALLDAAVDEFDDSD
ELSVYGRASDQSLLEDVLDDYDGATYAGERDCLGGVVVESGESRVRVNNTFDSILEDVWE
DNLKAISDRLFEDQ
Download sequence
Identical sequences A0A0B5GNJ3 A0A165NCD2 G0HT28 M0KDP8 V5TJI3
WP_008311110.1.13069 WP_008311110.1.27393 WP_008311110.1.67629 WP_008311110.1.92404 WP_008311110.1.92869 WP_008311110.1.94779 gi|564288719|ref|YP_008874938.1| gi|344210715|ref|YP_004795035.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]