SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|344210879|ref|YP_004795199.1| from Haloarcula hispanica ATCC 33960

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|344210879|ref|YP_004795199.1|
Domain Number 1 Region: 1-149
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.28e-31
Family GHMP Kinase, N-terminal domain 0.0000708
Further Details:      
 
Domain Number 2 Region: 155-290
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 6.66e-29
Family Homoserine kinase 0.00068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|344210879|ref|YP_004795199.1|
Sequence length 291
Comment homoserine kinase [Haloarcula hispanica ATCC 33960]
Sequence
MLTVRAPATSANLGSGFDVFGVALERPADVVRLEKADRVTIEMTGAGSQYIPEDPDKNTV
GAVAEALDAPARIQIDKGVRPASGLGSSAASAAAAAVGLNELYDRGYSREELVPIAAKGE
AVVSGDAHDDNVAPSIMGGFTIATEKGVTQVDADIPLVACLPDIVVSTRDARNVVPETAR
VDQMVETVGNAASLTTGMHRDDPELVGQGMHDTVVTPARAKLIDGYEQVREAALTAGATG
VTISGAGPTVIAACAEEDRRKIASTMLDAFGDCGVDARVYQTRIGGGAEVF
Download sequence
Identical sequences G0HUG0
gi|344210879|ref|YP_004795199.1| WP_014039554.1.67629 WP_014039554.1.92404

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]