SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|344211218|ref|YP_004795538.1| from Haloarcula hispanica ATCC 33960

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|344211218|ref|YP_004795538.1|
Domain Number 1 Region: 189-494
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 2.35e-64
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0000148
Further Details:      
 
Domain Number 2 Region: 17-191
Classification Level Classification E-value
Superfamily Globin-like 1.61e-34
Family Globins 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|344211218|ref|YP_004795538.1|
Sequence length 497
Comment heme-based aerotactic transducer HemAT [Haloarcula hispanica ATCC 33960]
Sequence
MELRDGSKNSRERISSSDRKAVDGGTLTDRIGLDAGEIRWRKEFTGFDESDVDNLTAMEA
KTNARAESVVDDFYDHLKSFDETIEIFGRSTKSVDQLKNTQSQYLRDLVAGSYDKQYFEN
RARIGKIHDMLDLGPKIYLGAYSIYFEHFLRTIVEDLQSGDAARDEALEEMQARALSVFK
LLNLDQQVAMDTYIDSYSQRLESAIDDQQALMEEVESGLQQPIDELSASAEEVAQTNQQI
TDTAETQSESMDEVAGEVADMSATIEEIASTAEEVASTSTSAEEKAERGNEAAQQAAAMM
NDVDDAVDTVSTDIAGLREQADEIDDIVEVINDIADQTNMLALNASIEAARAGEAGDGFA
VVADEIKTLAGDSQEHANQIEDTVTEIQDETVDAVESLETVTEQVTEGIDQVETAAEQLE
EIVSAVNEAAQGIQEVSAATDDQAASTEEVASMIDELSSGIDDMSAQLDDLAATNEEQTE
KIQDVAETARRLDTDTE
Download sequence
Identical sequences G0HWC8 V5TJ52
WP_014039850.1.67629 WP_014039850.1.92404 gi|344211218|ref|YP_004795538.1| gi|564289215|ref|YP_008875449.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]