SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|344211310|ref|YP_004795630.1| from Haloarcula hispanica ATCC 33960

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|344211310|ref|YP_004795630.1|
Domain Number 1 Region: 5-251
Classification Level Classification E-value
Superfamily Metallo-dependent phosphatases 2.69e-46
Family 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain 0.00065
Further Details:      
 
Domain Number 2 Region: 259-450
Classification Level Classification E-value
Superfamily 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 2.09e-39
Family 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 0.00031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|344211310|ref|YP_004795630.1|
Sequence length 452
Comment 2',3'-cyclic-nucleotide 2'-phosphodiesterase/5'-nucleotidase [Haloarcula hispanica ATCC 33960]
Sequence
MSPRIIQYSDVEKAYDTPERIGRFAGTVAAADGPDALVVGTGDNTGPGVLSLVTDGEQSL
DLFTALTPAFETLGNHDFDHGLDATRDIIARSPQTWLTANVEQDGERFARRLTRPWASRT
VDGKQLGFVGVTDPDTAAANPQATTLTFTDPLEAVAEAATALRADGADVIVVLSHLGRTD
EELARTCDVDVILGGHVHERRIDRVAGTLLTRPGANGKTVVEVDLGGPEPTAQFRETADG
PVDDRVAEAIEDRLSAAGLDEVVGHVEEPLDRSRATTYGGECRLGNLVADAYRWATGADV
GLQNSGGLRNDTVPLDGALTVGDMVSVVPFEEPLTVAELTGSELRTLCRQGSGRQVEFGE
PDWWHAHLSGVELIWNDDTQTIERLRVDGRPVREAETYTLATSNYLYYTEREFPVLTESH
RVSVADVQYEALADYVRQTDIAPTVDGRLTRR
Download sequence
Identical sequences G0HX30 V5TLM8
WP_014039930.1.67629 WP_014039930.1.92404 gi|344211310|ref|YP_004795630.1| gi|564289303|ref|YP_008875540.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]