SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|344212904|ref|YP_004797224.1| from Haloarcula hispanica ATCC 33960

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|344212904|ref|YP_004797224.1|
Domain Number 1 Region: 7-62,207-407
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 2.29e-46
Family Bacterial dinuclear zinc exopeptidases 0.013
Further Details:      
 
Domain Number 2 Region: 87-195
Classification Level Classification E-value
Superfamily PA domain 1.28e-16
Family PA domain 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|344212904|ref|YP_004797224.1|
Sequence length 442
Comment aminopeptidase [Haloarcula hispanica ATCC 33960]
Sequence
MDDTDWIGETFTSTAGWDHLETLVDIGNRMAGSDGERAAAEATRDALAAYARDARLSEFA
IQGWERGDSAVHVDGSPVAAQAHECIALPRSPAGEVTGELVDVGHGLPEEFEDADCEGKV
VLARSDVPDWYDRYIHRREKYYHAVEAGAVGFVYRNHVEGVLPPTGSVGTADAPIGEIPA
IGVASETGARLSRRYAGNDITVSVDCGTPDATSQNVHAELGPDTDERLLVTSHVDAHDIA
EGAMDNGAGTAMVVEAARALAGREDELETRVEFVAFGAEEVGLVGSNRLADETAPDDVTA
VLNFDGVVQSRTLKCYTHGFDALAAAAEDVADRFDHPISLTPEQGPHSDHWPFVRRGVPG
YHVTSETGGEGRGWGHTHADTLDKLEPRTFREQAVLLTELAVTLADDSVRSAHKDPAEIA
DALEAQNLAEGMRITGDWPFDD
Download sequence
Identical sequences G0HQT5 V5TPF3
gi|344212904|ref|YP_004797224.1| WP_014041320.1.67629 WP_014041320.1.92404 gi|564290832|ref|YP_008877149.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]