SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|344209533|ref|YP_004785710.1| from Haloarcula hispanica ATCC 33960

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|344209533|ref|YP_004785710.1|
Domain Number 1 Region: 4-38
Classification Level Classification E-value
Superfamily TTHA1013/TTHA0281-like 0.0000628
Family TTHA1013-like 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|344209533|ref|YP_004785710.1|
Sequence length 73
Comment hypothetical protein HAH_4051 [Haloarcula hispanica ATCC 33960]
Sequence
MWREGDSWIITDVETGITTQGETRQEALEMLDDAVAGYKGERGHEPTDEELRELGIDPED
NTTGNGDLPDFMQ
Download sequence
Identical sequences G0HZD1
gi|344209533|ref|YP_004785710.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]