SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|563696955|ref|YP_008869705.1| from candidate division WWE3 bacterium RAAC2_WWE3_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|563696955|ref|YP_008869705.1|
Domain Number 1 Region: 89-285
Classification Level Classification E-value
Superfamily PheT/TilS domain 4.45e-62
Family B3/B4 domain of PheRS, PheT 0.0000156
Further Details:      
 
Domain Number 2 Region: 354-508
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 3.13e-21
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0026
Further Details:      
 
Domain Number 3 Region: 294-362
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 0.000000000000229
Family Domains B1 and B5 of PheRS-beta, PheT 0.0034
Further Details:      
 
Domain Number 4 Region: 5-68
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 0.00000000000126
Family Domains B1 and B5 of PheRS-beta, PheT 0.001
Further Details:      
 
Domain Number 5 Region: 531-619
Classification Level Classification E-value
Superfamily Anticodon-binding domain of PheRS 0.00000562
Family Anticodon-binding domain of PheRS 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|563696955|ref|YP_008869705.1|
Sequence length 620
Comment hypothetical protein P147_WWE3C00001G0439 [candidate division WWE3 bacterium RAAC2_WWE3_1]
Sequence
MNVLIPFSWLKDYVKTNAGIRDVAKALSEHSFSVEKIIDDDTLEIEVTPNRGDGLSVLGI
ARELAAVLPVKGFSADWVKKSFPVKKYSGRDKLKVKISDNSLVPRFSAVVIDKVKVKESP
ALVKERLSKVGIRAINNIVDVTNYCMIELGQPMHAFDYNKITGHEMTVRESKRGEEIVTL
DGVKRVLPEGVIVIEDGDGRLIDLCGIMGGLNSEVDENTTKVLLFVQVYDPVRIRKSSMS
LGHRTEAALRFEKGVDFESVIPSLQTAVGMLTELSGGEVSSELIDLTGTVYTKKHIKIDY
EKINKIAGTEIKKDFVNSTLTSLGFVIKGSDVYVPSWRYDDIEIIEDLAEEVIRIYGYQE
LPNELPGGTLPHHTKTDNFALEDKTKDFLKHMGFFECYNYSAVPGSMAGHGALKVKNPLN
ADLEFLRTSLTPKLLDVLNKNKGYSETVKLFELSSVYLAKKGDLPEQPYMLGMVARGVDF
LVFKGIVEALFEELGVTGDFPYEITEHSGAIISCELPFDKMVDSAGGSRVYSPLTGFNSI
KEDITIIVGDATSFSEIVSVVSSTDVRVNKVGFKDMYEDALTLSIEFLDRAKQITSEETK
GIRDAIIKNLDSKYGIKLKV
Download sequence
Identical sequences K2DB75 V5RSS1
gi|563696955|ref|YP_008869705.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]