SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|563697081|ref|YP_008869831.1| from candidate division WWE3 bacterium RAAC2_WWE3_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|563697081|ref|YP_008869831.1|
Domain Number 1 Region: 2390-2675
Classification Level Classification E-value
Superfamily Pectin lyase-like 1.47e-19
Family Galacturonase 0.047
Further Details:      
 
Domain Number 2 Region: 25-75
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 0.0000000307
Family DNA-binding N-terminal domain of transcription activators 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|563697081|ref|YP_008869831.1|
Sequence length 4474
Comment YapH protein [candidate division WWE3 bacterium RAAC2_WWE3_1]
Sequence
MEISAQNNKKNYSKSDSNVFRSEGYVKVSEAANLLSVSSSTLRRFEAEGKITSRRLDNNY
RVYDISEVARFKKILNEEKQTRKKSYVTVNDTPVFQNKTPVKAHGFTWPKINASFPKINE
TYSNVSQNFEQHSTLKAAAKFFKTAKIAGVSFAAVLILIGLSENVRFTDNVIEILSFTMS
RQIETGEKGYEVIGLTLGSKDKVTSYIYNINVPANFRRNVNIDETLRVTGLSSLLGGIET
QDADANLGTGTLTTGRIDMTGEASLNNLLVINDVTETTLEEFIDINGDVVGTGLNDVKVV
GLGGIEVGDLDTDDGNILMIEGGSWASLPTSSITSLGTITTGVWNGTPIAPGYGGTGLSS
ITAGSILIGGSGNTMSTLAIGSANQTLISSGSAPVWTNSDAFVSSYAWLLTGNTGTDSTT
DFIGTTDNTGLTIRTNDVERVTIAADGNVGIGGTDPQFSLHVGNGSSSAAWIVGQQESGY
IEGDLEVAGTIYGTFVGPITTVGYQPNAVFYSDSAGTMTTDNTLLSFNETTAVLLVNGTL
NTSLFKIGGTSVTSSATELNILDGALISTTELNLLDGRIGTLVDSSNVSNYAITSVVAGS
GLIGGTGPGATTLHVGVGNGISIAADSIAIDTTTTGVTAVSSSNSGLEASSDGLRLLGGC
GSNQILSWDATGQVWKCASVSGIGGITGAGASTQVAFWDSASSLTGNNSLWWNNTSTRLG
IGTSAPLYTLDVNGTARIGSLSAGSGNSIVLQNAGVLETRDVDSRVWGTSLVDGTSLTAN
YLARISDANTLITGMVYDNGSFVGIGTTQAGYLLNIGGSLNTSALFIAGSAVTSSATELN
ILDGVTATTSEINMLAGRTGTLVDSNNVGSYAVTAITAGSGLTGGTGPGATTINIGAGNG
LIVSADSIAIDSATTGLTAVTSSNSGIEVTADGIRLLGGCSLNQVLAWDNTSQTWKCSSV
SGLGGVTGTGTDNYLARWDGTSALQNSSVFAADSGNVGIGTSGPGYNLDVAGSANVSNLF
IAGNLVSSSATELNILDGALVSTAEINLLDGRTGVLLDTSNVSTQLSTWDQLASDDLTTA
TGFSGDVSGPYNDLQIQTGVVGANELAATSVSAGTYGSTSGVSTFTVDADGRLTSAGNTT
LSGAGITDNTIEEVDLEVTNAGVNGYVLTYDNATGGFTWVSSAVMGTNYWQRIGSNLVPL
TVTDYVTTNGRIGAGTTSPSYTLDVNGTARIGSLSAGSGNSIVLQNAGVLETRDVDSRVW
GTSLVDGTSLTANYLARISDANTLITGMVYDNGSFVGIGTTGNSGYILNVAGSANVSNLF
LAGTLVSSSATELNILDGATLSTTELNLLTGRTGTLVDSNNVGSYAVTAITAGSGLTGGT
GPGATTINIGAGSGISLAADSITLDTDTTGTTSVTSNNSGLEVTGSGLRLLGGCSDTQIL
KWNSTASVWYCSSDSTGTSGTATIAGSGLATQIAFFSGSTSISGSNNLWWDNTGGNLGIG
TSGPAAKLELAGSADTEQFVIKANATQSNTNPLIQLQSSTGTALLDISTDSVENVFIGRL
AGSSNTVGAGSSGMYNTFIGSGAGDNNSAGYQNSVLGAYALFGNTYGINNTSMGVYSLFS
NTTGNDNVSLGFKAGQYSTTGSYNVFLGTSAGFGVNTTQRALSSYNVAIGNEAGYSLSAN
SSSNIFLGYRAGYNETGSNKLYIDNGSAPGGSAFIYGDMSSDLLTFNANVGIGKTSPTAW
LDISAATTSKPSIRVASGTAPSSPVTGDIYNNGTSLYYYNGTAWQDLGATGTSGTAAIAG
SGLATQVAFFSGSTSISGSNNLWWDSGNSRLGIGTSGPAYPLSVLSTAPDVADGRVADVD
GTLTSSTNDQQGFKTSVTVTPGASTSKIYSGMQLSLSGNSNTRLTNAIFRGVEGYISYSG
SSGILGTGIGGRFRVNNSSTGTITNAYDLYLATPTNTGTITNTYGLYIDSMTAGTQPNKA
FGIYQAGSGDRNYFAGNVGLGTTNPASILQVAGNILPSADDTYDIGSSALRWRDVYIGPA
SLHIGTNQSEATIKYLVGQSSLGFDLDANGVYEFEMGADGKFGIGTTNPNFMLDIAGSAS
VNTLFLGGSAITATAAELNRLSGGSGNVVDTGNVGSYAVTAITAGSGLTGGTGPGATTIN
IGAGSGISLAADSITLDTDTTGTTSVTSNNSGLEVTGSGLRLLGGCSDTQILKWNSTASV
WYCSSDSTGTSGTATIAGSGLATQVAFFSGSTSISGSNNLWWNSTDSRLGIGTSAPLTSL
DVSGTTWLRGLSANSGLFVNASGSIGIGTTNPQYNLHVVGNLGLTGDFYLLGAPSSPSTT
EGTMYYDTDDDRLKVYANGKWQSDRTTATVIVAASDSKNKEKADIVADGTNDETDIENAV
TNYLPATGGNVVLLDGTYNIGADGIDITKSNVTLTGAGNATVVKRVADSTAVDGTITLGD
GGTTAVTNVKITELQVDGQKSAYSSPNNVAIFFNQRVTQSQIEGTYIHDIYSYGIYLKGT
TQSVSDNTIHNNTIINSSNPIYVDAGSTSTRAHNISITNNNISSGVAGIYINYAKYFKVS
DNKFSNYQYILSVDNSEYGVISGNTTDGSTITGVNTAMVISLGASNYNTIVSNYIYGGSG
MGGSAAIYVDNTSTGNYIAGNTLGNNKITDSGIGTIIQQDDRFLVNGYLKATSLYLSGTQ
VTSSATELNILDGATLSTTELNLLTGRTGTLVDSNNVGSYAVTAITAGSGLTGGTGPGAT
TINIGAGSGISLAADSITLDTDTTGTTSVTSNNSGLEVVADGLRLIGGCTDTQILKWNAS
TSMWYCAADSTGTAGSATIAGSGVVNQVSFFSGSTSISGSNNLWWDNSNTRLGIGTSGPL
TALDVSGTTWLRGLSANSGLFVNTSGYVGIGTTNPTAPLSVGTGSAFAVSSTGAVTSGSW
NGAAISVPYGGTGLTSIAAGSVLAANSVDTLSVITSTSGLKVLQNSAGTTSWATTTGTGN
VVFSDSPVLTTQAMVPLIVGGSSPTSVLTLKSTSGTGTTDAIVFQVGTNGGTEAMRILNS
GNIGIGTTSNAYKLFVDGSLNATSLYLSGSQVTSSATELNILDGATLSTTELNLLTGRSG
TLLDSGNVGTYATTAVTAGSGLSGGGTTGALTINIGGGNGITINADDITIDATTAGTTTV
KSNNSGLEVVSDGLRLLGGCANGEVLKWNSSTSVWYCAVDTTGSGTATIAGSGIAGQLTF
FTGSTAVSGSNNLWWDNTGGNLGIGTSGPVAKLELAGSADTEQFVIKANATQSNTQPLIQ
LQSPTGTPLLSITSDNETNAFFGYRAGSANTYGSATSGGGNTFIGYLSGSSNNAGYQNTS
VGGEALSRNTTGVYNSGLGYQSLYSNTTANYNTAVGFQALYSNTLGSANIGVGFGAGVYN
QTGTGNLFLGHKAGYGGAARTGSDFNAAVGYEAGYSLSANSDSNIFLGYRAGYNETGSNN
LYIDNTSSPADTAFIYGDMGLDRLTFNANVGIGKTSPTAWLDVAAATTAKPSIRVATGAE
PSSPVTGDIYNNGTSLYYYNGTAWKDLTATGAGGGLAGSGIAGQLTFFTGSTAVSGSNNL
WWDSGNSRLGIGTSAPLTSIDVSGTTWLRGLSANSGLFVNQSGYTGIGTTSPISKLQVEG
PTWLRGGTGVAGAKGVYIDANSNLGIGTTNPGYLLTLNTTTDQHAIAFLEGTTNRAFFGL
AASAGQFAAGSRDNDLIWRSESGSNQLWTTDGGTTAMVTLNSGGNLGIGTTAPLAWFDVK
GATTSEASIRVRSGTQPSAPATGDIYNDGDQLFFYNGTAWQDLGATTAGGGGIAGSGIAG
QLTFFTGSTAVSGSNNLFWDTSNSRLGIGTSAPASQLALLSTDTTNGQFRIGYDASNYTK
FTTDSVGNLTLNNNGTNVVKFGATNTEFYTPTTFSAAGDVSMAYDLIFTNATSSELRSYG
PLSITAGETYGSSNLTLKTYNSGDIVADLTGTGRLRLNGADTTLLFDTKTATDTDYWMGV
IDDAGGDDDDMFAIGKGLSNSSNIYLSIASSGWVGLGLPATSAPTATLDVNGGARFRGIG
SSAYVGAVNYATGGVLTTATSDARLKTNVTTIDNALDKVTRLRGVTFNWLDPNAPKRMTG
MIAQEVADVMPELVFQNPNDGYYGLFYGETTGLLIEATKELNTKLLALESGLTTYTTTAD
GTLSTITTSTDSNLTKLNTLETDVTALQTEVLSIKELLAQAAPQSSQSSATVATTPEGML
AEMYKVFEDLKAFVAALGLSNNGNALAVSTDLNVLGDTTLSNLTVTGDISAGLMKLDTLN
NVFEVAGPSCYNELTGTTNTTLCTDQTMYLQKSLAGNVDVLNGALVVEPNGNVTVKGTLL
AQKVETTDISTENVTIKAASKSVGSGTITSGQTQIVIDNTLIKTGSKVFVTATSSTNGQA
LIVKEKLDGVSFTVAVDRPVPGDVAFDWWIVNVE
Download sequence
Identical sequences V5RVA4
gi|563697081|ref|YP_008869831.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]