SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|563697090|ref|YP_008869840.1| from candidate division WWE3 bacterium RAAC2_WWE3_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|563697090|ref|YP_008869840.1|
Domain Number 1 Region: 7-56
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 0.00000101
Family DNA-binding N-terminal domain of transcription activators 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|563697090|ref|YP_008869840.1|
Sequence length 302
Comment hypothetical protein P147_WWE3C00001G0579 [candidate division WWE3 bacterium RAAC2_WWE3_1]
Sequence
MINLEDKLYTSTEVADILGVSLRSVYRYIEEDKLQAEVKTATGRHRFTKKNILDFLYPGG
AEEKAGQPLPKETIKPEVKETKKKEKVEEPVEEAEEVGEETPIEPETPAVEEPAPKEKEV
PAEEEPIDWLAKFREAAKKFDEENAKRVEASSKPAVAEEKETFASITEQEPVAPKNPLFF
YRSRLGGLKDIAQNIDKSSRNSGLDYAFTMNAGLSLFKAIKPFSLLHVYVRSKDKDFFER
ILMLTPSDENNAQLCIMTNDDKDLYASSEELHGLFVADKGRLLADIRKHGDADLIEEAES
IL
Download sequence
Identical sequences V5RT39
gi|563697090|ref|YP_008869840.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]