SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|386713364|ref|YP_006179687.1| from Halobacillus halophilus DSM 2266

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386713364|ref|YP_006179687.1|
Domain Number 1 Region: 1-110
Classification Level Classification E-value
Superfamily Hypothetical protein YfhH 2.62e-42
Family Hypothetical protein YfhH 0.0000277
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|386713364|ref|YP_006179687.1|
Sequence length 114
Comment hypothetical protein HBHAL_2050 [Halobacillus halophilus DSM 2266]
Sequence
MERRFSDMSQEELRQEIADLTEKAQKAEQFGMVNEFAVHERKIIMAKSYMINPRDFGPGE
LYEIEGDPENTFYIQYMNGVFAWGYRRNQAGVKVTEESEEALPISMLGQKIENK
Download sequence
Identical sequences I0JJU2
WP_014642314.1.51524 WP_014642314.1.59131 gi|386713364|ref|YP_006179687.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]