SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|386713498|ref|YP_006179821.1| from Halobacillus halophilus DSM 2266

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386713498|ref|YP_006179821.1|
Domain Number 1 Region: 3-113
Classification Level Classification E-value
Superfamily YheA/YmcA-like 7.98e-41
Family YheA-like 0.0000349
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|386713498|ref|YP_006179821.1|
Sequence length 119
Comment hypothetical protein HBHAL_2191 [Halobacillus halophilus DSM 2266]
Sequence
MSNIYDHAYDLEKAIRNSEEFTSLKEAYEAVMNDEAAKKMFEDFRQTQVTLQQKQMQGEE
ISEEEVEEARKVVELVQQHPQISKLMEEEQRLNTVINDVSKIITKPLEELYGNPEEPQQ
Download sequence
Identical sequences I0JK76
WP_014642448.1.51524 WP_014642448.1.59131 gi|386713498|ref|YP_006179821.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]