SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|386713984|ref|YP_006180307.1| from Halobacillus halophilus DSM 2266

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386713984|ref|YP_006180307.1|
Domain Number 1 Region: 146-345
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 1.83e-58
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.00000082
Further Details:      
 
Domain Number 2 Region: 429-561
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 3.4e-36
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.00000582
Further Details:      
 
Domain Number 3 Region: 12-145
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 1.8e-28
Family Duplicated SiR/NiR-like domains 1 and 3 0.002
Further Details:      
 
Domain Number 4 Region: 347-422
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 9.32e-20
Family Duplicated SiR/NiR-like domains 1 and 3 0.00044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|386713984|ref|YP_006180307.1|
Sequence length 571
Comment sulfite reductase (NADPH) beta subunit [Halobacillus halophilus DSM 2266]
Sequence
MSKERDSQQHGPPSEMEGIKKESRYLRGSLVESLQNPITGSVPDSDTKLMKFHGSYMQDD
RDLRQERKQQKLEPAYQFMTRVRLPGGVATPDQWLVMDEIANTYGNHTLKLTTRQTFQTH
GVLKWNMKKQIQMINDSLMDTIAACGDVNRNVMCNANPYQSDIHGEIFEWSKKVSEHLLP
RTQAYHEIWLDGEKVEDSKDEYEVEPIYGSLYLPRKFKIGIAVPPSNDIDVYSQDLGFIA
IVENNELKGFNVAVGGGMGMTHGDTNTYPQVSRVIGFCEPEKIVDVAEKILTIQRDYGNR
SERKNARFKYTVDRHGLDWVRQELHDRLGWELEEERSYMFDHNGDRYGWVEGDGLWHLTL
FIQNGRIKDSEDNQVMTGLREIAKVHDGEFRLTPNQNVIIARVEEEKKQEIDELVEQYGL
TDGRYNSALRRNSMACVAFPTCGLAMAESERYLPSLIDKMDDVIDEAGLQDEEIVIRMSG
CPNGCSRPALSEIGFIGKGPGKYNMYLGGGFTGNRLNKLYKENIGEEEILGTIKPMLFEY
AKERQENEHFGDYVIRAGYIEEVQSGLDFHS
Download sequence
Identical sequences I0JLL3
gi|386713984|ref|YP_006180307.1| WP_014642927.1.51524 WP_014642927.1.59131

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]