SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|386714169|ref|YP_006180492.1| from Halobacillus halophilus DSM 2266

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386714169|ref|YP_006180492.1|
Domain Number 1 Region: 191-603
Classification Level Classification E-value
Superfamily beta-lactamase/transpeptidase-like 4.27e-89
Family beta-Lactamase/D-ala carboxypeptidase 0.00000993
Further Details:      
 
Domain Number 2 Region: 54-239
Classification Level Classification E-value
Superfamily Penicillin binding protein dimerisation domain 1.06e-40
Family Penicillin binding protein dimerisation domain 0.000075
Further Details:      
 
Domain Number 3 Region: 656-709
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.00000000000262
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0043
Further Details:      
 
Domain Number 4 Region: 597-654
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.00000000109
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|386714169|ref|YP_006180492.1|
Sequence length 713
Comment penicillin binding protein 2B [Halobacillus halophilus DSM 2266]
Sequence
MKNPNTHRGAALLILVFSFVFLIIVGRFLYIETTATVEGVDLKEWAEEIRTSSYKIDADR
GKIYDKNGMVLAYDRPMYRLQAIVDPDYSANLENPKHVTDPEKVASNLAPLLGLKKSEMI
ETIKNGQENDRFQVEFGANGREISQEEMEEIKDLNLNGITFQEEAKRYYPNGVFASHLIG
FARSQDGDIKGITGIEKQMQKYLKEEEGKISYERDKYGTKLLDPNQVMKEPDDGENVYLT
IDQKIQTFLEDAMSQVDEQYSPEKIMAGVMDPDTGQILAMSNRPSYNPNDLGEVENWYND
LIAYPFEPGSTMKMFTWASAIEEGVYDGDELYKSGRYQVTENSSTIGDHNNGEGWGMISF
NEGFQRSSNVAASILAYEKLGPDMFKKYLSDFHLNQQSGIDLPGEKTGSFVFDKPIEQIT
TAFGQGSTVAPIQLMTAATSIANDGKMMKPYILSKISSSKDGEVIKERSPEVIGEPISKS
TASQVRDLMGQVVTSENGTGQKFKLDDFSLAGKTGTAQISKPGGGYMTGRENYTFSFMGM
APKDDPELLMYVAVQQPNLDNTEYGSDPVSHIVKTVMENSLHYLDIKPDEESQTKVSQVK
LPDVTDLSVEKATSRLKENFNRVEVIGQGSEVERILPEPGAEVLKNQRIMVITDQPTMPD
LTGYSLRDVHRLAEYFGFNIETMGNGYVTKQSIAPGSEIKEEGYLVVELAPPE
Download sequence
Identical sequences I0JM48
gi|386714169|ref|YP_006180492.1| WP_014643111.1.51524 WP_014643111.1.59131

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]