SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|386714170|ref|YP_006180493.1| from Halobacillus halophilus DSM 2266

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386714170|ref|YP_006180493.1|
Domain Number 1 Region: 172-571
Classification Level Classification E-value
Superfamily beta-lactamase/transpeptidase-like 1.51e-100
Family beta-Lactamase/D-ala carboxypeptidase 0.0000273
Further Details:      
 
Domain Number 2 Region: 53-221
Classification Level Classification E-value
Superfamily Penicillin binding protein dimerisation domain 1.11e-41
Family Penicillin binding protein dimerisation domain 0.0016
Further Details:      
 
Domain Number 3 Region: 586-639
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.00000000458
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|386714170|ref|YP_006180493.1|
Sequence length 640
Comment stage V sporulation protein D (sporulation-specific penicillin binding protein) [Halobacillus halophilus DSM 2266]
Sequence
MRRVSQVIVKKRLITVFLVGMVIFGVIIGRLGYVQFVLSDFLIAKAEESWSRDITFEPER
GNIVDTNGEVLVGNQSAPTVMVVPRQVKDPETTAKNLAQILEMSVEKAYTHVTKQISIEK
IHPEGRKISEDKAEAIQSLGMPGVYIAEDSERYYPHGSFLSHVLGFSGIDNQGLLGLEAY
YDDELKGEKGALSFFSDAKGKRMPDMADIYNPPVDGKDLQLTIDYKVQAIIERELDIAQS
KYNPDGAVALAVDPDTGKVVAMASRPNFNPANYQEVEPMVYNRNLPVWSTYEPGSTFKII
TLAAALEENLVDLHEEHFHDSGAVKVDGATLHCWKRGGHGDQTFLEVVQNSCNPGFVQLG
QRLGKDKLFEYIDRFGFGEKTGIDLEGEGKGILFKPENVGPVEQATTAFGQGVSVTPIQQ
VMAVAAAVNGGYYYEPYIQEAWLDPVTGEAEEKNEPKVKDRVISEETSAQIRKALESVVA
KGTGRGAYVEGYRVGGKTGTAQKVGPDGRYMENNHIVSFIGFAPADDPELVVYLAIDNPK
DTVQFGGVVAAPIVGNIMEDSLRALEVKPRKDGLEKEYTWPDEPLVEVPNVTGLEKKELN
QLLTNLKIEASGKGDKVITQAPEAGVKVPSGSKVRVYMGN
Download sequence
Identical sequences I0JM49
gi|386714170|ref|YP_006180493.1| WP_014643112.1.51524 WP_014643112.1.59131

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]