SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|386715377|ref|YP_006181700.1| from Halobacillus halophilus DSM 2266

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386715377|ref|YP_006181700.1|
Domain Number 1 Region: 2-135
Classification Level Classification E-value
Superfamily FlgN-like 0.00000000000000144
Family FlgN-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|386715377|ref|YP_006181700.1|
Sequence length 164
Comment hypothetical protein HBHAL_4085 [Halobacillus halophilus DSM 2266]
Sequence
MTLKTVIQCMDHLKQLHESLLGLSRRKTEALKSNDTNSLQQLLTQERKHVQAINKVEKQR
GEAVVSWCEAQGLPTYEPTISNMIANLEGESQGKLEAVYKEMILVLSSLKQQEQLNAQLT
KQSLQFINMSLDMLQPSLESVNYGGKSAPSRNNKTKRSIFDSKA
Download sequence
Identical sequences I0JQK6
gi|386715377|ref|YP_006181700.1| WP_014644315.1.51524 WP_014644315.1.59131

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]