SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|386716355|ref|YP_006182679.1| from Halobacillus halophilus DSM 2266

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386716355|ref|YP_006182679.1|
Domain Number 1 Region: 4-63
Classification Level Classification E-value
Superfamily Replisome organizer (g39p helicase loader/inhibitor protein) 0.00000122
Family Replisome organizer (g39p helicase loader/inhibitor protein) 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|386716355|ref|YP_006182679.1|
Sequence length 108
Comment hypothetical protein HBHAL_5073 [Halobacillus halophilus DSM 2266]
Sequence
MNYEEAVEVLKTIEEVYVGKFPLTKRKVTLWTAELEKMKYDQVMRRLTNHVVKSPFPPTL
SEIAVYEVSDNGMAEKMARWKKEAAEVSEETKRLFLEKLDEMERKMDK
Download sequence
Identical sequences I0JTD6
gi|386716355|ref|YP_006182679.1| WP_014645290.1.51524 WP_014645290.1.59131

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]