SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|389845670|ref|YP_006347909.1| from Haloferax mediterranei ATCC 33500

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|389845670|ref|YP_006347909.1|
Domain Number 1 Region: 1-139
Classification Level Classification E-value
Superfamily Transposase IS200-like 1.18e-35
Family Transposase IS200-like 0.0000505
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|389845670|ref|YP_006347909.1|
Sequence length 143
Comment IS200-type transposase (TCE31) [Haloferax mediterranei ATCC 33500]
Sequence
MVKSTRHAKYELYYHIVFVPKSDGIGDSADLAEQGSAQYRRSHLTGKTKERLETIFAEIC
EDKGLELAESEVMPDHVHLFIGSPPKNAPSLIVNWVKGISARKYNQRYDDRVKWTRSYYV
GTAGSASKDAVEQYIAEQEGGNE
Download sequence
Identical sequences I3R112
gi|389845670|ref|YP_006347909.1| WP_004058466.1.26851 WP_004058466.1.35700 WP_004058466.1.77170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]