SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|389846276|ref|YP_006348515.1| from Haloferax mediterranei ATCC 33500

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|389846276|ref|YP_006348515.1|
Domain Number 1 Region: 8-61,200-403
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 4.29e-48
Family Bacterial dinuclear zinc exopeptidases 0.0062
Further Details:      
 
Domain Number 2 Region: 65-191
Classification Level Classification E-value
Superfamily PA domain 0.0000000000000955
Family PA domain 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|389846276|ref|YP_006348515.1|
Sequence length 435
Comment aminopeptidase [Haloferax mediterranei ATCC 33500]
Sequence
MSDWIGDTFTSEVGWEHLETLVDIGNRMAGSPGEREALEATRDALERVGARNARIDPFEI
QGWERGNSAIYAHDTTQDCIALPRSPAGTASGELVDLGYGLPEDFDRDLSGKVVVVSSTV
PDHYDRFIHRREKYYYAVEAGAAGFVFANHVPGQLPPTGSVGTAEAPIGDIPAVGVSKEV
GARLGRRFEGDEVTLDVTCEAPAADSGNVHAELGPDTDEEVLVTSHLDAHDIAEGAMDNG
AGTAMVVELARALAAREGELETRVRFVCFGAEEVGLVGSEYEADRLGPDRSNVKAIVNND
GVVAGRTLKLHTHGFDELEDAAETVSERFDHDISTIPEQLPHSDHWSFVAYGIPAYMVGS
EKEGRGRGWGHTHADTIEKLESRTLREQAILLTELTVELARADREVPHADPNDIAAALEA
EDKAEGMKVTGDWPF
Download sequence
Identical sequences I3R2R8
gi|389846276|ref|YP_006348515.1| WP_004057424.1.26851 WP_004057424.1.35700 WP_004057424.1.77170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]