SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|389847006|ref|YP_006349245.1| from Haloferax mediterranei ATCC 33500

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|389847006|ref|YP_006349245.1|
Domain Number 1 Region: 26-213
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 9.11e-53
Family GHMP Kinase, N-terminal domain 0.0000548
Further Details:      
 
Domain Number 2 Region: 219-398
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 4.16e-47
Family Galactokinase 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|389847006|ref|YP_006349245.1|
Sequence length 402
Comment galactokinase [Haloferax mediterranei ATCC 33500]
Sequence
MTESNRQTESSQQTEHGPVNRARAGLQTAFGTGSNTQDPVVALAPGRVNLVGGHTDYNDG
LCLPMAVDRYVAVAARPRDDDLLRVHATDFDGTARIAPGDDPDGWAAYIAAVARVLREQV
PIPGSDLAIASTVPSGAGLSSSAALELATGRALLAVADAELPTTDLALACWRAEREGVGV
ECGILDQFAVGLCKSDSALFLDCRTREYEHVPLGGAVGILVIDTGVSHELADSGYNDRVR
ECREAVTALRDASGRPLDTLRDVDRDLLESHADALEPVHYRRAKHVVTENERVNVARDAL
SAGDFERVGEAMVAGHESLRDEYEVSSPELDAAVELATEVDGVYGARMTGGGFGGSAVAL
VDGDELGCAKEAIRAVLPERVGSDARVFACRPSGGVGLVHSR
Download sequence
Identical sequences I3R4U8
WP_004056904.1.26851 WP_004056904.1.35700 WP_004056904.1.77170 gi|389847006|ref|YP_006349245.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]