SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|389847375|ref|YP_006349614.1| from Haloferax mediterranei ATCC 33500

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|389847375|ref|YP_006349614.1|
Domain Number 1 Region: 14-74,215-412
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 8.86e-39
Family Bacterial dinuclear zinc exopeptidases 0.01
Further Details:      
 
Domain Number 2 Region: 97-170
Classification Level Classification E-value
Superfamily PA domain 0.0000000000235
Family PA domain 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|389847375|ref|YP_006349614.1|
Sequence length 451
Comment aminopeptidase [Haloferax mediterranei ATCC 33500]
Sequence
MASGWNMDDLSPDARDVFARTWTDDRPWEFLTQLTAVGNRMAGGEGDRRASSLVADAFVD
AGAQHVEFDTFEMAHWSRGQTTLELTAPDERSFEAIALPYAPAADVSGPLVDVGYGTPSE
IDEHDVNGAIAVASTTTPSGGRFIHRIEKFNYAIESGAVGFVFVNHIPGQLPPTGALRYD
EEALAPAVGVSKETGSWLAEYASRDGTARLTVDAATEPGESRNVEGHVGPDTEREVVFCA
HFDAHDIAEGALDNGCGITTVATAVRLLAAMDLDLGVRVVGVGAEELGLTGAEHLVNRLD
LDRVATVVNVDGAGRFRDLVAMTHTSEATAEVASRVADETRHPIRVDETPHPFSDQWPFV
RAGIPALQLHSDSGERGRGWGHTHADTRDKVDDRNIREHAMLAALLVRELATAAANDEIP
GLDDDELATAFRQADFEKGMKAAGIWPGGWE
Download sequence
Identical sequences I3R5W7
gi|389847375|ref|YP_006349614.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]