SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|389847562|ref|YP_006349801.1| from Haloferax mediterranei ATCC 33500

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|389847562|ref|YP_006349801.1|
Domain Number 1 Region: 246-534
Classification Level Classification E-value
Superfamily Metallo-dependent phosphatases 3.75e-44
Family 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain 0.0047
Further Details:      
 
Domain Number 2 Region: 547-738
Classification Level Classification E-value
Superfamily 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 8.63e-34
Family 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 0.00039
Further Details:      
 
Domain Number 3 Region: 1025-1074
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.00000157
Family Type I dockerin domain 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|389847562|ref|YP_006349801.1|
Sequence length 1080
Comment UDP-sugar hydrolase / 5'-nucleotidase [Haloferax mediterranei ATCC 33500]
Sequence
MASAAADTDITALETTNQFAMDEAAGPADVSITELQSNTTDGDASAYEGQVVNTSGTVTA
TNANGFFLQDASADDVQHSGVYVYTGGAPSVAPGDVVDVEAPVKEYNGLTELDLTGDNAT
VSTTGSESVPEATPISTADAAQEAYEGVFVNVTDLEVTKTPGQYGEWAVTDGSSAIAVDD
KTTGDETTPSENGSTIDAIEGPVFYSFGAFKLQPATVSNLTAPGTGGGDGGDGGSGDGSD
NTTSPNETTITLVGYNDIGKAAAGSGDDELGRMITLIEQQRANADGPVFVAGGGDELSPH
ALRNYDGLDKPYEPPVTALNLINPDAEVVQNHELDYDEDAGANDFAVFEAISNESTYPWL
LANVVHEDTGKNLPGTQNYTVVERDGVRVGFFGLTDEAINAKTDGVMERNGYKVLDPTTA
AQRTTNTLRNEENVDVVVALAPLGIPDSKQLARDVDGMDALISGDDHQRYSPQQTDGVLI
GETSGKASAIMSMKLTVEDGTVTDSSGELVDVTTNTSRNETWKNYINPLREEYLNTKLAT
AVMPEHTGVGSSYTDDSATGHLVTDGVRNYTGADVAVTNAGGIRDTLYPTDKYGAGETFN
ITRGMVTSTHSFGNTIVVVEVTGAELREVVKSQITPLGMENQYGTQTQEQVSGVTFEWVP
HSDSASPSEGDATVQDLTVNGEPVNDSETYTLAVNSYIADGGSSYPLADAPRVKVYNETT
MAEGVIGYLQNRSTIEAVEVDTESDDRMRRVDTVVDASAVDMSASNGQTPFTIDAPSRVT
GVDGAAAFADRNGTYVTTTNVTYDGQSGTVTVTVPTDELAAFETAPLAPNSGIDLYVDYT
DSEYSSQYENFDTAVLNVDLETGSPTPTPSQSVALAIGDSDGPVPLGDEREFEITASDVE
QGIGAYEMTVTVGDAEVARITDVSFASEPGFSEVHISENGTSADIAVAGAEASASDEQVL
ATVSVEGVTLNESTTLELTPTAGPYAQNGSSYGVSEIDNRQVTVEPGDVTGNGQKMADPD
GDGTFEDINGDGSVDIIDAQALFVNRESDTMQSNVDAFDLNDDGKVNVGDVQRLFYGADV
Download sequence
Identical sequences I3R6F4
gi|389847562|ref|YP_006349801.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]