SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|389848431|ref|YP_006350670.1| from Haloferax mediterranei ATCC 33500

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|389848431|ref|YP_006350670.1|
Domain Number 1 Region: 28-337
Classification Level Classification E-value
Superfamily DNA ligase/mRNA capping enzyme, catalytic domain 1.51e-104
Family Adenylation domain of NAD+-dependent DNA ligase 0.000000233
Further Details:      
 
Domain Number 2 Region: 421-607
Classification Level Classification E-value
Superfamily RuvA domain 2-like 4.95e-48
Family NAD+-dependent DNA ligase, domain 3 0.0000693
Further Details:      
 
Domain Number 3 Region: 339-415
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 6.68e-25
Family DNA ligase/mRNA capping enzyme postcatalytic domain 0.00055
Further Details:      
 
Domain Number 4 Region: 615-690
Classification Level Classification E-value
Superfamily BRCT domain 0.0000000000000766
Family DNA ligase 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|389848431|ref|YP_006350670.1|
Sequence length 699
Comment DNA ligase (NAD) [Haloferax mediterranei ATCC 33500]
Sequence
MTSADVDAESNPYLRDPPTDFEDAETLSREEAESQAELLREAIREHDHRYYVEAEPLISD
AAYDALFSRLVALEGTFDLDTTNSPTSRVGGEPIEALETVEHVAPMLSIDQSTDAADLRE
FDERVRREVGDVAYVCEPKFDGLSIEIVYEDGAFVRAATRGDGQRGDDVSAQVKTIPTVP
LSLRGDYPDQLAVRGEVYMPKPDFSDLNARRVEAGEDPFANPRNAAAGTLRNLDPSVVAD
RPLAVFFYDILGSSATPDSQWESLDHLRDWGLRVADRIERVEDVEGAVDYRNRMQDARDD
LDYEIDGTVIKVDSRAARDELGTKSRSVRWAFAYKFPARHEVTTIRDIVVQVGRTGRLTP
VAILDPVDVGGVTVSRATLHNPDEIDELGVAVDDRVRIKRAGDVIPQVVEVVEDAGGSYD
FPDECPVCGSQVDRDGPLAFCSGGLSCPAQREASIGHFAIKGAMDIDGLGEERVSQLVEA
GLVETVADLYDLTVSDLTELERWGETSAQNLVDAIESSKVPSLDSFLVGLSIPEVGEATA
RALAREFGSIDGFPIGEDVSASDFDEFESRLTTVADVGETVARRVRDFFENKNNRAVIRS
LLDHGVEPEPVETGGDELAGLTFVVTGSLAVSRSAVSELVESHGGNVTGSVSGNTDYLVI
GENPGQSKRDDADENDVPTLTEAEFEELLAEYGVSYPPE
Download sequence
Identical sequences I3R8X3
WP_004058868.1.26851 WP_004058868.1.35700 WP_004058868.1.77170 gi|389848431|ref|YP_006350670.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]