SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|389845828|ref|YP_006348067.1| from Haloferax mediterranei ATCC 33500

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|389845828|ref|YP_006348067.1|
Domain Number 1 Region: 1-225
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.63e-67
Family G proteins 0.00000546
Further Details:      
 
Domain Number 2 Region: 449-604
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 8.85e-42
Family Translational machinery components 0.00022
Further Details:      
 
Domain Number 3 Region: 244-364
Classification Level Classification E-value
Superfamily Translation proteins 9.98e-27
Family Elongation factors 0.0027
Further Details:      
 
Domain Number 4 Region: 608-702
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 1.34e-21
Family EF-G/eEF-2 domains III and V 0.0015
Further Details:      
 
Domain Number 5 Region: 372-447
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 3.02e-18
Family EF-G/eEF-2 domains III and V 0.0004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|389845828|ref|YP_006348067.1|
Sequence length 713
Comment translation elongation factor EF-2 [Haloferax mediterranei ATCC 33500]
Sequence
MDKPEQIRNIAIAAHVDHGKTTLSDNLLAGAGMISDETAGQQLAMDTKEDEQERGITIDA
ANVSMTHEYEDENHLINLIDTPGHVDFGGDVTRAMRAVDGALVVVDAVEGAMPQTETVLR
QALREGVKPALFINKVDRLINELQEGPEEMQQRLVDVISDVNDLIRGMTEEKDYDWTVSV
EEGTVAFGSALYKWGVSMPSMEETGISFGDIMELERASNRQELHERTPLSDVVLDMVAEH
FPDPLDAQPRRIPTVWRGDAESDLAHQMRDVDDDGEVVFMVTDIAMDPHAGEIATGRLFS
GTIRKGQELYVSGTAGKNRVQSVGVFMGSEREELDRGIPAGNIAAVTGLRDAIAGSTVSS
VEMTPFESIEHISEPVITKSVEAERMDDLPKLIETLQQVAKEDPTIRIEINEDTGEHLIS
GQGELHLEVITQRIRDNQGIPVRTGEPIVVYREQVQGSSHEVEGVSPNRHNKFYITAEPL
SQDIVDDIKLGEISMDMPELERREALQEAGMDKDTSQNVEHIHGTNILIDDTKGIQHLNE
TMELVIEGLEEALDDGPLAAEPVQGTLLRLHDAKLHEDTIHRGPAQVIPATRDAVHRSLI
AGEVKLLEPIQNVRIDVPSDYMGSASGEIQGRRGRVDDMYQEGDLMVIEGIAPVEEMIGF
SSDVRSATEGRASWNTENAGFRVLSDNLQREKIMEIRERKGMKLELSQAIDYI
Download sequence
Identical sequences gi|389845828|ref|YP_006348067.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]