SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|345004101|ref|YP_004806954.1| from halophilic archaeon DL31

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|345004101|ref|YP_004806954.1|
Domain Number 1 Region: 37-291
Classification Level Classification E-value
Superfamily PLP-binding barrel 3.78e-53
Family Alanine racemase-like, N-terminal domain 0.000076
Further Details:      
 
Domain Number 2 Region: 263-422
Classification Level Classification E-value
Superfamily Alanine racemase C-terminal domain-like 2.51e-45
Family Eukaryotic ODC-like 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|345004101|ref|YP_004806954.1|
Sequence length 436
Comment diaminopimelate decarboxylase [halophilic archaeon DL31]
Sequence
MSDVPEGPRAASDGGPAVRRLADWEANTLAELAAEHGTPLYVFDPARARENCRRLTAAFP
DTEIQYAAKAHTGRRTLQTVHDEGFAIECASAGEVQRALAAGIPGSDVTYTAVNPPARDL
DAVVKTWEEHPSLTITAGAADTLDRLAERGFDGRLRIRVNPGIGAGHHEKVVTGGHPKFG
VGLDRVPELAESAAERFEFAGIHAHAGSGISGEQLADHRELVSRMGALARTLEDRGLPVE
TVDVGGGFGVPYREKAPALDLEAVAAATREALGETDATLAIEPGRYVVADAGVLLTTVNT
VKEAPEMVVGGIDAGMTTLLRPALYDAYHAVRNLDTETDDGEDRETVGATLAGPVCETAD
LLCENRPLPRPERGDLLAVGNAGAYGYEMASTYNTRPLPAEVGLDGDLLRRRGTVADVTE
FEEPNGFAAAAPRSDQ
Download sequence
Identical sequences G2MIF4
gi|345004101|ref|YP_004806954.1| WP_014050362.1.75361

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]