SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|345004182|ref|YP_004807035.1| from halophilic archaeon DL31

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|345004182|ref|YP_004807035.1|
Domain Number 1 Region: 4-271
Classification Level Classification E-value
Superfamily Folate-binding domain 3.45e-54
Family Aminomethyltransferase folate-binding domain 0.00037
Further Details:      
 
Domain Number 2 Region: 275-357
Classification Level Classification E-value
Superfamily Aminomethyltransferase beta-barrel domain 0.0000000000000343
Family Aminomethyltransferase beta-barrel domain 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|345004182|ref|YP_004807035.1|
Sequence length 367
Comment folate-binding protein YgfZ [halophilic archaeon DL31]
Sequence
MTLVGGSHADHGATFSERGGREVVEEYGRADRAVRAVRNGVGVIEMGYGVVVITGDDRVE
FVDNAVTNNVPSENGAGCYALLLDPQGGIETELFIYNAGERLLLFTPPDRAEELVEDWSG
KVFIQDVDIREATTDFGVFGVHGPQATEKVASVLHKAGAPAGAYSFVRGSMGDAGVSVIA
GDAPTGEESYEIVCAAADAGEVWMTLLSRGNGAFPFGYRTYETLTLEAGTPLFDTELRGE
IPNVVGLRAALDFEKGCYVGQEVVSRVENVGQPSRRLVGIQLGDGDVTADDPLPDGGAAV
FAGDAAVGEVTRACWSPTLEAPIALALVGWDTDDISAVRVDGTERPAERVDLPFVEGSEQ
SGRLPRY
Download sequence
Identical sequences G2MJB3
WP_014050443.1.75361 gi|345004182|ref|YP_004807035.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]