SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|345004309|ref|YP_004807162.1| from halophilic archaeon DL31

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|345004309|ref|YP_004807162.1|
Domain Number 1 Region: 92-298
Classification Level Classification E-value
Superfamily Oxidoreductase molybdopterin-binding domain 5.49e-56
Family Oxidoreductase molybdopterin-binding domain 0.0000161
Further Details:      
 
Domain Number 2 Region: 364-458
Classification Level Classification E-value
Superfamily E set domains 7.7e-23
Family Molybdenum-containing oxidoreductases-like dimerisation domain 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|345004309|ref|YP_004807162.1|
Sequence length 496
Comment sulfite oxidase [halophilic archaeon DL31]
Sequence
MAQNQQQSEDDEPQRETGESTRRDRFVERRRFLMAAGSLAGVGVLAGCGGNDTETESPTG
TETDAPPSTPEPTEEPTDEPTEEPDQEPSLGERYPGLRILSPEPENAEAATRETYTDYIN
PREEHYIRNHYPTPDIDENNWTISLTGLVDEEIELSMDDIKHDFATDSITHTMQCAGNGR
SYFDPQVGGNQWSFGAVGNTVWTGTPVADILEYYGADMADGRFLTVMGGEHPEGEDVFTR
SIPMEKVKKDVMLAYEMNGSPVSPDHGFPVRLLVPGWFGCNNVKWANRMHVMETMVIGDE
WEEEGAPENGARTYTHWQQYSYRIVPEEDDGATQYEDIPVYDTREQMNRTDEIDNAYMYD
QLEKSLIGYPRDESTISTSPAGTIEVIGVAWAGDDAVETVEVSADGGETWNEAEFFGPVD
SPNGWRQFRYVWENPSAGEQTLHSRATDERGYTQPAEIADQSAQLRGIENDQYPWDQGGY
GNNAYVPHGVSFTVEE
Download sequence
Identical sequences G2MIK8
WP_014050570.1.75361 gi|345004309|ref|YP_004807162.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]