SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|345004666|ref|YP_004807519.1| from halophilic archaeon DL31

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|345004666|ref|YP_004807519.1|
Domain Number 1 Region: 5-294
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 6.54e-59
Family Diacylglycerol kinase-like 0.0000494
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|345004666|ref|YP_004807519.1|
Sequence length 301
Comment hypothetical protein [halophilic archaeon DL31]
Sequence
MTQKIIIHNPGSGRGDHDESVRRRADELGYTLKQTQTAGDAVTLAAEAAEAGFSTVVAAG
GDGTVNEVVRGIDRANAFDDVEFGILPLGTGNNFAEQIGIPDLETAFAVLEDGDRRRIDL
GYANERLFVNSCVAGLTAESSSETPSEMKRQLGVLAYVLTTLRTVSDFELLRLTVDIEDA
GQETTAWAGDALCVLVGNGRRYGTSGTSQANMEDGLLDVVVIEDVSALDLMSDTVVERMF
GRDSASIKRFKSSSVEIEIDNPDATRFSLDGEIIREQELSLTVRPQTLTVAVGETYDSNP
D
Download sequence
Identical sequences G2MKP5
WP_014050927.1.75361 gi|345004666|ref|YP_004807519.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]