SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|345005243|ref|YP_004808096.1| from halophilic archaeon DL31

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|345005243|ref|YP_004808096.1|
Domain Number 1 Region: 18-65,215-415
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 6.01e-40
Family Bacterial dinuclear zinc exopeptidases 0.014
Further Details:      
 
Domain Number 2 Region: 92-172
Classification Level Classification E-value
Superfamily PA domain 0.000000000127
Family PA domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|345005243|ref|YP_004808096.1|
Sequence length 453
Comment peptidase M28 [halophilic archaeon DL31]
Sequence
MVELPDEVVGDAQTSHFAWNRLEELVDVGNRMAGQAGEAQGAEVIRDAFADAGLDGVRID
EFEIPGWWRGSSSLTVGAPVERVHEGSHQVIALPGSPSGETTGRVVDVGAGTYEEFEAKA
DKLEGAIAMASSETPEHADRWLHRMEKYVNAADHGAAAFVFRNHIEGALPPTGEVGYHNR
PGPIPAVGVSKEVGARLERYAEEGECEATVVTECRNEETTSRNVEAVVGPSDADDEVLVT
AHVDAHDIADGANDNGAGSVLTAEVGRLLTSVADDLDSRVRLVTFGSEEIGLWGAYHCAE
MTDLDQVKCVINLDGACSSRNLRVGTNEFDALGELFESVAADFDAPLSTGDTISPHGDQW
AFVQEGVPSTMTATTSNQSGRGWGHTHADTLDKLDSRDLRDVATLVTEAVYRAAQDSFSV
EHRSRAETRDAIDEGYIQELKMGGRWPYDDLEE
Download sequence
Identical sequences G2MLH4
WP_014051500.1.75361 gi|345005243|ref|YP_004808096.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]