SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|345005580|ref|YP_004808433.1| from halophilic archaeon DL31

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|345005580|ref|YP_004808433.1|
Domain Number 1 Region: 29-143
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000000143
Family Tetracyclin repressor-like, N-terminal domain 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|345005580|ref|YP_004808433.1|
Sequence length 375
Comment hypothetical protein [halophilic archaeon DL31]
Sequence
MQHDQYVVDLSADERAELNALLASGTHKTRVLTRARCLLHADDGLTDDEVSQAVGCHPTT
VGRYRKRYTEDGLAAITRRKADRIYERKLDGREEAHLIALACSDPPEGRSRWSLHLLADH
FVGLTEIDVESISHETVRQILKKTQLHPHRSKSWVIKPENSAAFVCKMEAVLDLYHEPFD
PLRPVVCFDESNKELHQEVRDPLPARPGAVARYDYTYERNGTRNLFVMSEPLTGWRHIEV
TQRRRKQEFVQQMQSLVDDHYPDAECIRVVMDNLNTHQRYAFYEFLPPEEARRLLSKLEF
HFTPEHGSWLNMAEIEFSALWTECLDRRIPDAATLRSEVAAWERSRNEDKSPIDWQFTTD
DARIKLRQLYPVNHD
Download sequence
Identical sequences G2MGX0
gi|345005580|ref|YP_004808433.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]