SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|345005850|ref|YP_004808703.1| from halophilic archaeon DL31

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|345005850|ref|YP_004808703.1|
Domain Number 1 Region: 11-64,205-405
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 1.91e-47
Family Bacterial dinuclear zinc exopeptidases 0.03
Further Details:      
 
Domain Number 2 Region: 84-162
Classification Level Classification E-value
Superfamily PA domain 0.000000000000798
Family PA domain 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|345005850|ref|YP_004808703.1|
Sequence length 439
Comment peptidase M28 [halophilic archaeon DL31]
Sequence
MDRFDAAIGRTWTDDRPWEFLTDLTAIGSRMGGSDGETEAADLVADAFREAGLDAVQQDP
FDLQAWHRGDSSLDLLTPRERTFETVALPYSPTGEVAGDLIDAGYGTPDEIDELDVEGKV
VVASTTTPDGGRFIHRMEKFGYAVEQGAVGFVFVNHVPGQLPPTGSLTFGREAEAPAVGV
SKETGAWLTDFADDGARVRLSVDAETVPAESQNVHARLGPETDEELLLLAHYDGHDIAEG
ALDNGCGVATILTAARLLAEADEELDRGVRVVAVGCEEVGLLGAEHLAEQVDDDEIAAVV
NVDGGGRFRDLVALTHTAESTGEAAERVSERANHPIRVQPQPHPFSDQWPFVRSGIPSLQ
LHSDSGERGRGWGHTHADTRDKVDDRNLREHGVLTALLVDELASMDAARLDTDELAAAFR
EAEFETGMKAASLWPEGWE
Download sequence
Identical sequences G2MMD1
WP_014052101.1.75361 gi|345005850|ref|YP_004808703.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]