SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|345006498|ref|YP_004809351.1| from halophilic archaeon DL31

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|345006498|ref|YP_004809351.1|
Domain Number 1 Region: 7-148
Classification Level Classification E-value
Superfamily Cytidine deaminase-like 5.69e-29
Family Deoxycytidylate deaminase-like 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|345006498|ref|YP_004809351.1|
Sequence length 151
Comment zinc-binding CMP/dCMP deaminase protein [halophilic archaeon DL31]
Sequence
MAFDDFDHEAHMRRAIELAREAADRGDGAYGSVLVKDDEIVMEERNAEVTDGDMRAHPEL
TLAKRAAAERDDAEALVMYTSTEPCPMCSGGIDLVGLDKVVYSVSGQRAGEIHGSGGLLP
STEVFAAGRSDVEVVPDVLHEAGEAVHRENR
Download sequence
Identical sequences G2MN49
gi|345006498|ref|YP_004809351.1| WP_014052737.1.75361

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]