SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|345006541|ref|YP_004809394.1| from halophilic archaeon DL31

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|345006541|ref|YP_004809394.1|
Domain Number 1 Region: 5-292
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 1.7e-55
Family Diacylglycerol kinase-like 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|345006541|ref|YP_004809394.1|
Sequence length 314
Comment hypothetical protein [halophilic archaeon DL31]
Sequence
MPTDSPIVVRNPRSGDGERTRQAREIALARDWEVLDAESGDHTVELAADAATRTDTVVAC
GGDGTLNKTVQGVREADCLDSVALGVIPAGTGNDFADNIGIRGVQNAFEVIETGDRRPLD
LGVANGRLFLNSCVGGLTAEASARTSPDLKQRLGVLAYVLTTLSVARDFEALELHVTAGP
ERDPVWEGDALMLLIGNGRRFPGEQRRQANMEDGLMNVVIIEDLPTLQYLTRGAADRLFR
RGASHLTRVKVSNLHVTHGGAPVQFSLDGEIIETAELTAETSPGAMRFCVGAGYEPSPDD
WGPPRRSNTFTVPV
Download sequence
Identical sequences G2MNP3
gi|345006541|ref|YP_004809394.1| WP_014052780.1.75361

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]