SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|345006739|ref|YP_004809592.1| from halophilic archaeon DL31

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|345006739|ref|YP_004809592.1|
Domain Number 1 Region: 5-61,202-402
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 4e-38
Family Bacterial dinuclear zinc exopeptidases 0.02
Further Details:      
 
Domain Number 2 Region: 75-188
Classification Level Classification E-value
Superfamily PA domain 0.0000000000916
Family PA domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|345006739|ref|YP_004809592.1|
Sequence length 438
Comment peptidase M28 [halophilic archaeon DL31]
Sequence
MADWLSETFRSEFGWDHLETLVDIGNRMAGQAGEMEGLEATRDALADAGARDARVERFDL
QGWVRGDSGIETPETTEESIALPRSPAGAETAELVDLGAALPEEYESTDVEGKIVVASSM
VPEYFPRYIHRTEKYQYAVEGGAVAFVYANHVPGQLPPTGSVGGSDGSPIGDIPAVGVSS
ETGARLGRRFDGEEVTVTVDCETPDAESGNAVAELGPDTEEYIILSSHVDAHDIAEGARD
NGAGTATIVEVARALAAREDELDTRVKCIGYGAEEVGLVGSELESENADLDSIKTVVNVD
SNMGGRTLELATHRFDELENAAQRVSERFDHPVSTVPRMVPHSDHWPFVRWGVPGYMVSS
NSEERGRGWGHTSADTLDKLESRTLREQSILLTELVVDVAGADVEIPHEEPATMATYLKE
EDQATGMKKTGGWPYDFE
Download sequence
Identical sequences G2MN71
WP_014052978.1.75361 gi|345006739|ref|YP_004809592.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]