SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|530547491|ref|YP_008428019.1| from Thermococcus litoralis DSM 5473

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|530547491|ref|YP_008428019.1|
Domain Number 1 Region: 270-461,846-1058,1091-1166
Classification Level Classification E-value
Superfamily PFL-like glycyl radical enzymes 1.83e-147
Family R1 subunit of ribonucleotide reductase, C-terminal domain 0.0006
Further Details:      
 
Domain Number 2 Region: 460-619,779-844
Classification Level Classification E-value
Superfamily Hedgehog/intein (Hint) domain 3.14e-41
Family Intein (protein splicing domain) 0.0031
Further Details:      
 
Domain Number 3 Region: 684-792
Classification Level Classification E-value
Superfamily Homing endonucleases 9.18e-20
Family Intein endonuclease 0.02
Further Details:      
 
Domain Number 4 Region: 9-155
Classification Level Classification E-value
Superfamily R1 subunit of ribonucleotide reductase, N-terminal domain 0.00000000000133
Family R1 subunit of ribonucleotide reductase, N-terminal domain 0.0076
Further Details:      
 
Weak hits

Sequence:  gi|530547491|ref|YP_008428019.1|
Domain Number - Region: 235-267
Classification Level Classification E-value
Superfamily R1 subunit of ribonucleotide reductase, N-terminal domain 0.000445
Family R1 subunit of ribonucleotide reductase, N-terminal domain 0.011
Further Details:      
 
Domain Number - Region: 614-683
Classification Level Classification E-value
Superfamily Homing endonucleases 0.051
Family Group I mobile intron endonuclease 0.08
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|530547491|ref|YP_008428019.1|
Sequence length 1280
Comment response regulator SirA [Thermococcus litoralis DSM 5473]
Sequence
MPVEKVMKRDGRIVPFDESRIRWAIQRAMWEVGVRDENLLDKIVKDVVDRINELYDGQTP
HIENIQDIVELELMRNGLFDVAKAYIIYRKKKAEIREEKRRILNKEKLDEIDKRFSINAL
RVLASRYLMKNEEGKIIESPKQLFERVAILAAIPDLLYDERVFSKEGGYAQDLKRVEYYL
QNLENFDNVYSIGRFKLNKYHFERMVNLYRELAEKGKMKVSIDEFLNMLDRGEFDKYEEV
VEEFFNLMVSQIFMPNTPALINSGRPLGMLSACFVVPIEDDMESIMKAAHDVAIIQKMGG
GTGLNFSKLRPEGDLVGTTTGAASGPVSFMHLIDAVSDVIKQGGVRRGANMGILEVWHPD
IEKFIHAKEQNVGTNVLSNFNISVGLWADFWEALKEGKRYPLINPRTGKKVKEIDPKSLF
EELAYMAWAKADPGVVFFDIINRRNVLEPAKGEKIRATNPCVVGDTRVLTPEGYLKIEEL
FRIAKERNEEKVVAVEGIAEEGEEFAYPITILLPNEEEKEVIYETAHGKQLAVADPIETK
AYVWKVGRKKVARVKTKEGYEITATLDHKIMTKDGWKAVEELKEGDLIALPRFEIEDDFG
SESIGEDLAFALGWFIGDGYINTNDKRVWFYFNAEKEEEMAHKISEILKKHFNSKAEPHK
YGSEIKLGVRGEAYRFFEKIVKTNEKRVPEIVYRLKPNEIRAFLRGLFTADGYVDNDSAI
RLTSRDRELLRDVQDLLLLFGILSKIYERPYKGTFEYTTKDGEKKIYEAQGYYELVIANY
SRKLFAEKIGFEGEKQEKIRLNKTKIDEPYARVDSVEFIGEEIVYDLTVPEIHSYVSNGF
MSHNCGEEPLYDYESCNLASINLAKFVKYDEEGKPYFDWDEYAQVIMKVAKYLDNAIDVN
KFPLPEIDYNTKLTRRIGVGMMGLADALFKLGIPYNSKEGYDFMRKATEYLTFYAYKYSI
EAAKKRGTFPLYEKTKYPEGELPIEGYYHREIWNLPWDELVEEIKRYGVRNAMVTTCPPT
GSVSMIADTSSGIEPIFALVYKKSVTVGEFYYVDPVFEAELKKRGLYNDEILQKISDNYG
SVQGLEEIPEDMQRVFVTAMDIHWLDHLLAQASIQLWLTDSASKTINMPNDATVEDVKAA
YLLAHALGCKGVTVYRDGSLSVQVYSVEGEKKKRVPAKPSEYAKKILREIVESESWLKKF
INVEAIIDGTNGKEVPTFSLSISRAQRQAEETAKERNVKDLLGVAYCPVCYEKDGELVEL
RMESGCATCPKCGWSKCVIS
Download sequence
Identical sequences H3ZK26
gi|530547491|ref|YP_008428019.1| WP_004066399.1.73549

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]