SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|530547509|ref|YP_008428037.1| from Thermococcus litoralis DSM 5473

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|530547509|ref|YP_008428037.1|
Domain Number 1 Region: 1-103
Classification Level Classification E-value
Superfamily GlnB-like 1.19e-36
Family Divalent ion tolerance proteins CutA (CutA1) 0.00000426
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|530547509|ref|YP_008428037.1|
Sequence length 104
Comment divalent ion tolerance protein CutA [Thermococcus litoralis DSM 5473]
Sequence
MGEMILVYTTFPDWESAERITKELLERKLIACANLREHKAFYWWQGKIEEDNEVGAVLKT
KVDLWSELKEALRELHPYSVPAIIRIDVDHVNKEYLDWLLEVTK
Download sequence
Identical sequences A0A124FF27 H3ZK09
gi|530547509|ref|YP_008428037.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]