SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|530547697|ref|YP_008428229.1| from Thermococcus litoralis DSM 5473

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|530547697|ref|YP_008428229.1|
Domain Number 1 Region: 12-188
Classification Level Classification E-value
Superfamily ClpP/crotonase 9.24e-30
Family Clp protease, ClpP subunit 0.019
Further Details:      
 
Domain Number 2 Region: 369-436
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00000000000000196
Family NfeD domain-like 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|530547697|ref|YP_008428229.1|
Sequence length 451
Comment nodulation protein NfeD [Thermococcus litoralis DSM 5473]
Sequence
MRKIIFISLLLLIFLGPALAEAKTVYVAQIKGEITSYTYDQFDRYISEAEKANANAIIIL
LDTPGGRADAMQNIIERIKSADVPVITYVYPPGAMAASAGTYIALGSHLIAMAPGTSIGA
CRPILGYSQNGSIIEAPPKVVNFYISYIKSLAKASGRNETMAEKFITEDLAIDPEEALKY
GVIEVIANDVDDLLEKADGMKTKVPVRGEYVTLDLKGAEVRYLEPSLKDRVITYITDPAV
AYVLLTLGIWALVLGFLSPGWHVPETAGAIMIVLAIIGLGYFGYRSAGLLLIILAVIFFI
AEALTPTFGLFTVAGFITFVLGSIMLFSGGGGVDYLISREVYSQIRLIIITIGALLALFF
AFGMAAVIRAHRRKAQTGKEEMIGLSGEVVEPLAPEGMIRVRGELWRARSRDGETINVGE
KVKVVGMDGLKLIVVREKEKKHEKENTNEVK
Download sequence
Identical sequences H3ZQP6
WP_004069721.1.73549 gi|530547697|ref|YP_008428229.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]