SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|530547784|ref|YP_008428316.1| from Thermococcus litoralis DSM 5473

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|530547784|ref|YP_008428316.1|
Domain Number 1 Region: 140-219,250-316,480-537
Classification Level Classification E-value
Superfamily Hedgehog/intein (Hint) domain 4.6e-20
Family Hedgehog C-terminal (Hog) autoprocessing domain 0.075
Further Details:      
 
Weak hits

Sequence:  gi|530547784|ref|YP_008428316.1|
Domain Number - Region: 464-625
Classification Level Classification E-value
Superfamily PHP domain-like 0.000314
Family PHP domain 0.019
Further Details:      
 
Domain Number - Region: 307-374
Classification Level Classification E-value
Superfamily Homing endonucleases 0.000316
Family Intein endonuclease 0.062
Further Details:      
 
Domain Number - Region: 5-144
Classification Level Classification E-value
Superfamily PHP domain-like 0.00314
Family PHP domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|530547784|ref|YP_008428316.1|
Sequence length 819
Comment Mja hyp1 intein [Thermococcus litoralis DSM 5473]
Sequence
MITDADLHIHSRYSKAVSKLMTFPILAENAKLKGLGIVGTGDILNPQWEKELLKAAQKVD
EGSYEIKGARFLLTAEVEDNRRVHHLLIFPSIDAVREMRERLNPYSKDIETEGRPHANLS
PAEIADLANELDVLIGPAHCVPPDTLLILRKGITKISDVKEGDEVLTHNGRFRRIARVYK
RKHTGNILKIKVRYIPEPIIVTPEHPIYAIKTSPACHGVRGICKPTCKRQFSMKKRGRNC
KRYYSTYKPEWVMAKDLKIGDVVLFPVLKEIRDIKRISLKEFIDSVASNKWKKDTPEEIE
VSKEFCRLVGYFLAEGSCFRDGITFSLSEEETDVIDDITTLLKEIFGVKPSIRNDKRGKG
YELKVYSRVLRNFFGEMFYIKGKEKRAWNKQLPHEFLYLPPEKQFEIFVGWWKGDGGVTT
SRILMNQMNIIAMRNGFISTFSRHKVKSAKIGKRNAKTTHDRWQARISTFNDEIENMLKK
RGITKLPKGDIRYGWFDGVYFYLPIIRIEKEPYDGIVYNLEVEEDSSYVTESGTLHNCFT
PWTALYKEYNSLKEAYGDAKVHFLELGLSADSYMADRIKAHHKLTYLSNSDAHSPMPHRL
GREFNRFEIEDATFDEVRKAILKRGGRKIILNAGLDPRLGKYHLTACSKCYTKYRLEDAK
RLNWRCELCGGIIKKGVHDRILELADTNEKPKDRPPYLHLAPLAEIIAMVLNKGVETKAV
KSVWERLLREFGSEIAVLVDVPIKSIAKLIGEEITKAIWAFRNEKLIVIPGGGGKYGEIK
LPEEVKKAKLEDIEGIEIKHEDVYYKPKQSSILSFLKKA
Download sequence
Identical sequences H3ZPN1
WP_004069089.1.73549 gi|530547784|ref|YP_008428316.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]