SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|530548359|ref|YP_008428897.1| from Thermococcus litoralis DSM 5473

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|530548359|ref|YP_008428897.1|
Domain Number 1 Region: 62-194,535-602
Classification Level Classification E-value
Superfamily Hedgehog/intein (Hint) domain 9.16e-42
Family Intein (protein splicing domain) 0.012
Further Details:      
 
Domain Number 2 Region: 1126-1231,1409-1425,1671-1733
Classification Level Classification E-value
Superfamily Hedgehog/intein (Hint) domain 1.39e-29
Family Intein (protein splicing domain) 0.0077
Further Details:      
 
Domain Number 3 Region: 628-744,1025-1064
Classification Level Classification E-value
Superfamily Hedgehog/intein (Hint) domain 1.75e-26
Family Hedgehog C-terminal (Hog) autoprocessing domain 0.063
Further Details:      
 
Domain Number 4 Region: 1822-1911
Classification Level Classification E-value
Superfamily post-AAA+ oligomerization domain-like 5.78e-22
Family DNA polymerase III clamp loader subunits, C-terminal domain 0.00000528
Further Details:      
 
Domain Number 5 Region: 273-367
Classification Level Classification E-value
Superfamily Homing endonucleases 2.1e-18
Family Intein endonuclease 0.0073
Further Details:      
 
Domain Number 6 Region: 1734-1804
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000000000677
Family Extended AAA-ATPase domain 0.0000334
Further Details:      
 
Domain Number 7 Region: 15-64
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000000000821
Family Extended AAA-ATPase domain 0.0002
Further Details:      
 
Domain Number 8 Region: 1061-1126
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000000000185
Family Extended AAA-ATPase domain 0.0000693
Further Details:      
 
Domain Number 9 Region: 1509-1620
Classification Level Classification E-value
Superfamily Homing endonucleases 0.000000000068
Family Intein endonuclease 0.048
Further Details:      
 
Domain Number 10 Region: 871-938
Classification Level Classification E-value
Superfamily Homing endonucleases 0.000000000623
Family Intein endonuclease 0.049
Further Details:      
 
Domain Number 11 Region: 1288-1369
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000000214
Family Lrp/AsnC-like transcriptional regulator N-terminal domain 0.039
Further Details:      
 
Domain Number 12 Region: 444-484
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 0.00000719
Family SinR domain-like 0.084
Further Details:      
 
Weak hits

Sequence:  gi|530548359|ref|YP_008428897.1|
Domain Number - Region: 775-859
Classification Level Classification E-value
Superfamily Homing endonucleases 0.00051
Family Intein endonuclease 0.046
Further Details:      
 
Domain Number - Region: 187-257
Classification Level Classification E-value
Superfamily Homing endonucleases 0.000646
Family Intein endonuclease 0.028
Further Details:      
 
Domain Number - Region: 1413-1495
Classification Level Classification E-value
Superfamily Homing endonucleases 0.000808
Family Group I mobile intron endonuclease 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|530548359|ref|YP_008428897.1|
Sequence length 1914
Comment Pab RFC-2 intein [Thermococcus litoralis DSM 5473]
Sequence
MAEEVKEVKEVKILEKPWVEKYRPERLDDIVGQDHIVKRLKHYVKTGSMPHLLFAGPPGV
GKCLTGDVKVIANGRLCELGELVEKVSNGRFGPTPVKGLKVLGIDEDGKLREFEVQYVYK
DRAERLIRIRTRLGRELKVTPYHPLLVNRKNGEIKWVKAEELKPGDKLAVPRFLPAIAEE
DPLAEWLGYFIGDGHADSRSNVITFTNADPSLRRRFMELTERLFPDAKIKERIHKNRAPD
VYVNSRKAWELVSALGFAGRKADKVYIPEKGWEGIRSFLRAYFDCDAGVDKNAIVLATAS
REMAEQVTYGLAGFGIISKIREKKVRGKLYYHVTISGSENVERFLSEIGFSHREKLEKAK
KLVKKFNPNLDSLKVNYELISYVRDRLKLNFSDDKRSWSHRKAREISWELMKEIYYRLDE
LERLKESLSRSILIDWNEVAERRKEIAEKTGIRVDRLLEYIKGKRKPSLRNYLKIAKALG
IDLEPTIDAMRVFARKYSSYAEIGRKLGTWNSSVRIILESNTEKIEKLEEIRKIELELIG
EILSDEKLKEGVAYLIFLSQNELYWDEITEVKELKGDFVIYDLHVPGYHNFIAGNMPTVV
HNTTAALALARELFGEGWRHNFLELNASVSKDTPILVRLNGKVMRTTFAELDKIYFDEND
GEVAYKDAMNLEVLTVDENYKVRWARVSKIIRHRVPVILKIHLEGGGTLELTGNHSVMVL
TENGLESVKASELKEGSYLLSFVSSVPGFLDVLNMEDYTVKPSARVRTFGEIPLNDELAY
MMGLYAAEGAVSFKGVTSGQVIYTLGSHEGELIERVREFAEGLGVSVYENYTTSGFDRSR
RSAYQIRLLSTQLARFFEDNFYDGHGRRSENKRVPGFIFEASLEERIAFLKGLADVDGSG
EWESVVRVSSVSKDMLIDTVWLARISGIEASLFEREARLIWKGGMKWAKAELLPAEPIIK
MLLRIEDAVEGNWRYNFRHQLYEGKKRVGKGILRDVLDMVNVEKLDDEGREIYETLRKLA
YTDLHALAIRKIELIEYNDFVYDVSVPGNETFFAGEIPVLLHNSDERGINVIREKVKEFA
RTKPIGGASFKIIFLDEADALTQDAQQALRRTMEMFSSNVRFILSCVTGDTRIYTPDERE
VKIKDFLKFYERGLVREVSNRNGRDTVIAAVAFNSKIIGHPVFRLTLESGRVIEATGDHM
FLTPAGWVQTYDLKEGSEVLVKPTLEGTPYEVNPEPIVDLRDFYEFANKLELERGRKPLG
EARNFRELTTKDKEKILARALELKAEMEKGLTEREAEILQEISTEWTSREEIQKKVGLSR
ARLNQLLKNLEEKGYVERRMEGKRQFVRKLRDGVPLRNTADVKRILEKELGIKISYTAVK
RLLAGELDGPAYNLLRELKKRWLVRYDDERAGILARVLGFLLGDGHLAKGGTRVWFNSSR
EELEALAEDLRRLGLKPSEIIERESSSEIGGRKVKGKIHMLYVDNRALHALMRFWGVEAG
NKTKKGYRVPEWIRKGNLFVKREFLRGLFAADGTKPYSEKYNFNGIKLEMRTSSESLEET
TEFFNDLAELLREFEVDSKVIVSPIGDGFIVRLVVTPNESNYLKFLTRVGYAYVKDKYAR
LVGEYLRMKLTYKEIILPQIAEKAVELAAKTNPTQAAKLLGVKRDFVVNRLNGVPIGLTR
DFMTFEDFRRERVTGDYVVEKVIKKEELGYLDVYDVTCASDHSFISNGLVSHNCNYSSKI
IEPIQSRCAIFRFRPLKDEDIAKRLKYIAENEGLELTEEGLQAILYVAEGDLRRAINVLQ
AAAALDVKITDENVFLVASRARPEDVREMMLLALEGNFLKARDKLREILLKQGLSGEDVL
IQMHKEVFNLPISEPKKVALADKIGEYNFRLVEGANEMIQLEALLAQFTLLGKD
Download sequence
Identical sequences H3ZM44
WP_004067704.1.73549 gi|530548359|ref|YP_008428897.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]