SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|530548450|ref|YP_008428991.1| from Thermococcus litoralis DSM 5473

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|530548450|ref|YP_008428991.1|
Domain Number 1 Region: 1-175
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 2.22e-67
Family Inorganic pyrophosphatase 0.0000000236
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|530548450|ref|YP_008428991.1|
Sequence length 176
Comment inorganic pyrophosphatase [Thermococcus litoralis DSM 5473]
Sequence
MNPFHDLEPGPEVPEVVYALIEIPKGSRNKYELDKKTGLIKLDRVLYSPFHYPVDYGIIP
QTWYDDDDPFDIMVIMREPTYPGVLIEARPIGLFKMIDSGDKDYKVLAVPVEDPYFNDWK
DISDVPKAFLDEIAHFFQRYKELQGKEIIVEGWENAEKAKQEILRAIELYKEKFKK
Download sequence
Identical sequences P77992
gi|530548450|ref|YP_008428991.1| WP_004067338.1.22775 WP_004067338.1.73549

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]