SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|530548615|ref|YP_008429157.1| from Thermococcus litoralis DSM 5473

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|530548615|ref|YP_008429157.1|
Domain Number 1 Region: 3-117
Classification Level Classification E-value
Superfamily Homing endonucleases 2.02e-17
Family Intein endonuclease 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|530548615|ref|YP_008429157.1|
Sequence length 125
Comment hypothetical protein OCC_13905 [Thermococcus litoralis DSM 5473]
Sequence
MFEVAKEYPREFLRGLFDSEGYVYLDPTTKKVSYVSLHNYDLELLEFSKSLLALLDIHSK
IRVSKKAGSPVVIRGKQYSYKSDLYELRVYRVESVRRFAKEVGFTIPRKQNKLREWLSIK
FNEHL
Download sequence
Identical sequences S5ZTQ2
gi|530548615|ref|YP_008429157.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]