SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|530548616|ref|YP_008429158.1| from Thermococcus litoralis DSM 5473

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|530548616|ref|YP_008429158.1|
Domain Number - Region: 283-319
Classification Level Classification E-value
Superfamily Mitotic arrest deficient-like 1, Mad1 0.000641
Family Mitotic arrest deficient-like 1, Mad1 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|530548616|ref|YP_008429158.1|
Sequence length 329
Comment hypothetical protein OCC_10479 [Thermococcus litoralis DSM 5473]
Sequence
MFRKKKNARGISWEYIKKRHSTIVNELKSLSGWDNIKASVVEAESLGEYSLVSLYVATEV
YRETRSQIEYLSEKVESINSRLESIRSENAEKLKQVERDIKEIKEKLEELEKRTLFLGSI
EKMIPRLTELEEKLEAYPSELITKLEKTYGHKINEEINQIVQERLKLIEEDLKRGIFGVS
VDLAETLKEIQGKYEKIILENYTLREELKEKDLQIAELTQRLTTLQKQLEIVNDLDKKLE
KYRKLAEEFRRMKESLIKITGIDDVDIALEELKEYVPKTKIKPLLDETKRLLAQIEELKK
ENEQLREENRRLESSLKKLLGKESPNSEF
Download sequence
Identical sequences H3ZR56
WP_004069994.1.73549 gi|530548616|ref|YP_008429158.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]