SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|530548764|ref|YP_008429310.1| from Thermococcus litoralis DSM 5473

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|530548764|ref|YP_008429310.1|
Domain Number 1 Region: 666-868
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.86e-63
Family RecA protein-like (ATPase-domain) 0.0004
Further Details:      
 
Domain Number 2 Region: 876-982
Classification Level Classification E-value
Superfamily C-terminal domain of alpha and beta subunits of F1 ATP synthase 2.62e-27
Family C-terminal domain of alpha and beta subunits of F1 ATP synthase 0.0036
Further Details:      
 
Domain Number 3 Region: 238-359,629-667
Classification Level Classification E-value
Superfamily Hedgehog/intein (Hint) domain 8.44e-27
Family Intein (protein splicing domain) 0.011
Further Details:      
 
Domain Number 4 Region: 468-554
Classification Level Classification E-value
Superfamily Homing endonucleases 0.0000000000000385
Family Intein endonuclease 0.047
Further Details:      
 
Domain Number 5 Region: 163-239
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000000000283
Family RecA protein-like (ATPase-domain) 0.014
Further Details:      
 
Domain Number 6 Region: 1-68
Classification Level Classification E-value
Superfamily N-terminal domain of alpha and beta subunits of F1 ATP synthase 0.0000000000228
Family N-terminal domain of alpha and beta subunits of F1 ATP synthase 0.0053
Further Details:      
 
Weak hits

Sequence:  gi|530548764|ref|YP_008429310.1|
Domain Number - Region: 96-177
Classification Level Classification E-value
Superfamily Single hybrid motif 0.0212
Family Biotinyl/lipoyl-carrier proteins and domains 0.0077
Further Details:      
 
Domain Number - Region: 390-459
Classification Level Classification E-value
Superfamily Homing endonucleases 0.0425
Family Group I mobile intron endonuclease 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|530548764|ref|YP_008429310.1|
Sequence length 1014
Comment V-type ATP synthase subunit A [Thermococcus litoralis DSM 5473]
Sequence
MGRIIRVTGPLVVADEMRGSRMYEVVRVGELGLIGEIIRLEGDKAVIQVYEETAGVKPGE
PVVGTGASLSVELGPGLLTSIYDGIQRPLEILREKSGDFIGRGITAPALPRDKKWHFTSK
VKVGDKVVSGDIIGVVPETSIIEHKIMVPPGIEGEILEIAEEGDYTIEEVIAKVKTPDGE
IKELKMYQRWPVRVKRPYKEKLPPEVPLITGQRTIDTFFPQAKGGTAAIPGPFGSGKCVD
GNTLVLTEEFGLVKIKELYEKLDGKGRKTVEGNEEWTELETPVTVYGYRNGRIVGIKATH
IYKGISSGMIEIRTRTGRKIKVTPIHKLFTGRVTKDGLALEEVMAMHIKPGDRIAVVKKI
DGGEYVKLTTSPDFRKSRKIKVPEVLDEDLAEFLGYLIADGTLKPRTVAIYNNDESLLKR
ANFLSTKLFGINGKIVQERTVKALLIHSKPLVDFFRKLGIPESKKARNWKVPRELLLSPP
SVVKAFINAYIVCDGYYHERKGEIEITTASEEGAYGLSYLLAKLGIYATFRKKQIKGKEY
YRIAISGKTNLEKLGIKRETRGYTNIDIVPVEVESIYNALGRPYSELKGEGIEIHNYLNG
ENMTYETFRKFAKLVGLEEVAENHLKHILFDEVVEVKYIPEPQEVYDITTETHNFVGGNM
PTLLHNTVTQHQLAKWSDAEVVVYIGCGERGNEMTDVLEEFPKLKDPRTGKPLMERTVLI
ANTSNMPVAAREASIYTGITIAEYFRDMGYNVALMADSTSRWAEALREISGRLEEMPGEE
GYPAYLASKIAEFYERAGRVRTLGSDGRIGSVSVIGAVSPPGGDLSDPVVQNTLRVVKVF
WALDADLARRRHFPAINWLTSYSLYVDSIKDWWHKNVDPEWKAMRDEAMALLQKESELEE
IVRIVGPDALPERERAILLVARMIREDYLQQDAFHEVDTYCPPKKQITMMKVILNFYHYT
MRAIDMGVPVEEIAKLPVREEIGRMKYNPNVEEIASLMKKTEEQFEELFKKYGE
Download sequence
Identical sequences H3ZKG9
gi|530548764|ref|YP_008429310.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]