SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|530549078|ref|YP_008429627.1| from Thermococcus litoralis DSM 5473

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|530549078|ref|YP_008429627.1|
Domain Number 1 Region: 64-127
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0000000209
Family NfeD domain-like 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|530549078|ref|YP_008429627.1|
Sequence length 129
Comment membrane protein [Thermococcus litoralis DSM 5473]
Sequence
MKTYVKNALKTLSILADEIAVGIFLFFILPRAGINVPLKPALAVIAFLIFKDVIAVKFLW
EVFEKKAEVGPEALIGKEALVVEELMPKGVVKVGNELWIAECINGTAKRGEKVKIIQVRG
TKLLVERQG
Download sequence
Identical sequences H3ZQ81
WP_004069524.1.73549 gi|530549078|ref|YP_008429627.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]