SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|530549352|ref|YP_008429902.1| from Thermococcus litoralis DSM 5473

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|530549352|ref|YP_008429902.1|
Domain Number 1 Region: 271-375,430-446,797-865
Classification Level Classification E-value
Superfamily Hedgehog/intein (Hint) domain 1.03e-34
Family Intein (protein splicing domain) 0.024
Further Details:      
 
Domain Number 2 Region: 515-607
Classification Level Classification E-value
Superfamily Homing endonucleases 1.19e-17
Family Intein endonuclease 0.0072
Further Details:      
 
Domain Number 3 Region: 2-132
Classification Level Classification E-value
Superfamily PIN domain-like 7.01e-17
Family PIN domain 0.018
Further Details:      
 
Domain Number 4 Region: 866-1033
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000000000341
Family RecA protein-like (ATPase-domain) 0.047
Further Details:      
 
Domain Number 5 Region: 1069-1115
Classification Level Classification E-value
Superfamily Prokaryotic type KH domain (KH-domain type II) 0.00000458
Family Prokaryotic type KH domain (KH-domain type II) 0.0094
Further Details:      
 
Domain Number 6 Region: 136-271
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000478
Family Nucleotide and nucleoside kinases 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|530549352|ref|YP_008429902.1|
Sequence length 1196
Comment twitching motility protein PilT [Thermococcus litoralis DSM 5473]
Sequence
MRVFVADTSVIVDGRLTQYLNRINEKVKVIIPEAVVAEIEHQANEGKAIGHTGLEELKKL
RKLADEDKILLEFYGERPDLWQIRRAKAGEIDHMIREVARELNAILITGDQVQRDIAIAK
GIEVIYLESRKEVKHRLEDFFDEHTMSVHLKAGVKPLAKKGKPGQWRLVPIRDEELTDEE
LEEIADDIVERAKRDPESFIELDEPGATVVQLRNYRIVIAKPPFADRIEITAVRPITKLS
IEDYDLPEKLLERLTDKAEGILIAGAPGEGKCLPPETPILLGDGSFVQIKDVKPGMKVVT
FSHEKVEVQPILRVYKRNETALIKLKTATGRKIILTPNHPVLTIKNGFVMWMDAGSLKKG
DPIAVPRMLPIKGNLPESIWIGELVKEGFFATTKDGNIVPLVKANPEDTVTVFYKGRNHR
KSRDVPAHLTLSEEFFEFLGLMWAEGSGSVFEFNNFDEKLIEHFKNLVSNIFGVKSEEFY
FVAPGRLRLRNSKTIEKILRAFGYPERNKASSLRVPEIVMKSDEKRIAAFIRGVFEGDGY
IGKELEISTASEEFAAGLQYLLLRLGIQALFKEKTINGKVYYKVVLKDSRSIRKFYEVVK
PRFKVKGFEKHLTKNSNPNIDTIPAGELVKSLGVLTGYRVKGATKTTYSRERLSKVYQNF
LSVYREYLALEPTVKKLVEYSKYISKWRELVEFIDKNVNIEFYRRNHIDHVAPKLWLEGK
RKPMMSTVAKLLSAFAYETGLLARESELWNKAVKEIRELMKSLFALLGQNSQSTVSQSMI
SLFLNGAELNVDRMLRLIEEVVSEYYHKAELVEEHLAHMLLMLDSNILWDKVASVETMIG
EFDVYDVTVPNHNFIAGILPVIVHNSTFAQALAEYYASMGKIVKTMEKPRDLQVSEEITQ
YTALGGRMEKTGDVLLLVRPDYTIFDEMRKTSDFKIYADLRLAGVGMIGVVHATKPIDAI
QRFIGRVELGMIPQIVDTVIFIKAGNVDKVLTLEYKVKVPSGMTEEDLARPVIEVRDFMT
GELEYEIYTYGEEISVVPVKKKEKPPAMKLAEKKLKQEIKKFLPDVYTEVELASPHKAII
YADEFDIPAIIGKKGKRISEIEKKLGISIDVRSFDEKLAEMPKEKIPVEAEEKKKQIVLR
VSPDFAKKPLKFFAGEQYIFTATPSRKGLVKVNKNTPIGKELKRVLDAGIELWASL
Download sequence
Identical sequences H3ZQK5
gi|530549352|ref|YP_008429902.1| WP_004069652.1.22775 WP_004069652.1.73549

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]