SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|530549701|ref|YP_008430256.1| from Thermococcus litoralis DSM 5473

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|530549701|ref|YP_008430256.1|
Domain Number 1 Region: 155-276,571-610
Classification Level Classification E-value
Superfamily Hedgehog/intein (Hint) domain 2.35e-35
Family Intein (protein splicing domain) 0.028
Further Details:      
 
Domain Number 2 Region: 610-853
Classification Level Classification E-value
Superfamily Radical SAM enzymes 2.49e-31
Family MoCo biosynthesis proteins 0.017
Further Details:      
 
Domain Number 3 Region: 447-544
Classification Level Classification E-value
Superfamily Homing endonucleases 4.76e-16
Family Intein endonuclease 0.015
Further Details:      
 
Weak hits

Sequence:  gi|530549701|ref|YP_008430256.1|
Domain Number - Region: 368-422
Classification Level Classification E-value
Superfamily Homing endonucleases 0.00013
Family Intein endonuclease 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|530549701|ref|YP_008430256.1|
Sequence length 1038
Comment molybdenum cofactor biosynthesis MoaA [Thermococcus litoralis DSM 5473]
Sequence
MEEITEGVPSGEREFGELTKGVRDLIEYPEISEEEFHELLTKASKDYGGPLPHRTWSLCP
ETRKVVPAVVWEKDGKVWITKKCPEGMITDVYYEDAEMYKRFEEWRYDFKIKSYNVENTG
VNCPFDCGLCPRHSSHTNLLNIVLTNRCNLSCWYCFPGYEEALFKFGGEVKLAKFEEIAK
MFSFEHTVQIEGFMGEYSIPENLYVLTYNNGKAEWTRVTKFLRRKHSGEIMVIKTRTGRE
IRTTPEHKFFIYENGKIVKKRADKLNVEDDLILLWNLETDERGEFEINLLEAFKSLPEEE
KEKIYVRGISKLDLLPLKEEYGDIIYQWKKSDSMPLSAFYKLGITEGEFRLGRDATSNEL
PSKLRITPEFAKLIGYFVSDGNYTNKDLRITVGHKDVEEEIISILNFLNLPYSILEWEGK
AKQIVVGSRLMRLVFKYVLGIPEGAPNKRLPKNFLNFPVEAKIALLSGLFNGDGYVVRGD
KVLHMGYASVSKGLIRDMLYLLASLGIFARVYMVPKEKMNGANHDLYKIYIAGTDLVKLV
EMLDLREGHRKKLNNIGDRKPSKVKKVSDFYIDTISEIKVENYEGYVYDLEVENESHSFV
ASDGILVSNCFFYAKEGQPIYEPTLEQIRMMLRNAKKEQPIGANAVQFTGGEPTLRDDLI
EIIRIAKEEGYDHVQLNTDGIRFAFEPELVRKIREAGVNTLYLSYDGMTPKTNWKNHWEI
PLIFENVRNAGGPGIVLVPTTIRNVNDHELGDIINFGLNHLDIVRGVNFQPISLVGRVPK
KERQRFRITIPGAIKRIEEQTNGAIAKEDWYPIPIAGHIARFFEAFAGRKYYMTSHFGCG
AATYVFLDEDRVIPISRFLDVEGLVEFLESKAEEIEKWKTLGKLQKLKLGAEIFLKFRSF
YDEKYAPKSFDVLKIMREAFTHGTYEALGQFHYKTLFLGMMHFMDEYNYDVERVERCVIH
YAMPDGRIVPFCTFNVIPELYRDKVQAQFSYTWEEWKALHPDWEYQKDKYVRTKEFIEKM
KGSELYRKTYIDIKNYFG
Download sequence
Identical sequences H3ZJR1
WP_004066266.1.73549 gi|530549701|ref|YP_008430256.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]