SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|530548999|ref|YP_008429547.1| from Thermococcus litoralis DSM 5473

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|530548999|ref|YP_008429547.1|
Domain Number 1 Region: 487-507,545-794
Classification Level Classification E-value
Superfamily HAD-like 3.3e-62
Family Meta-cation ATPase, catalytic domain P 0.0000607
Further Details:      
 
Domain Number 2 Region: 292-388
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 1.7e-30
Family Calcium ATPase, transduction domain A 0.0043
Further Details:      
 
Domain Number 3 Region: 73-138
Classification Level Classification E-value
Superfamily HMA, heavy metal-associated domain 1.2e-22
Family HMA, heavy metal-associated domain 0.00056
Further Details:      
 
Domain Number 4 Region: 2-68
Classification Level Classification E-value
Superfamily HMA, heavy metal-associated domain 5.24e-21
Family HMA, heavy metal-associated domain 0.00057
Further Details:      
 
Domain Number 5 Region: 253-292,389-481
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 0.0000000000000144
Family Calcium ATPase, transmembrane domain M 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|530548999|ref|YP_008429547.1|
Sequence length 801
Comment copper-exporting P-type ATPase A [Thermococcus litoralis DSM 5473]
Sequence
MEINIKITGMSCASCAKTIEVALKELEGVKDVKVNLATETAYVKFDESKVSITQIIRAIE
SVGYGVVREKRDAIIKIGGMTCASCVKTIETALRELPGVLDVKVNLATEKATVSYDPTLV
DMEEIQKIIEEFGYQFLGVEGEESIDIEKEVRERHLRDMKKKLIVAWTFGGIITLMTYRW
LLGFNFEIPYMLWIQFALATPVIVYSGREMFLKAIRSLRHKTLNMDVMYSMGVGSAYIAS
VLATVGILPKEYNFYEASVLLLAFLLLGRYLEQVAKGRTSEAIKKLMGLQAKKATVIRDG
KEVEIPITQVRVGDIVIVKPGEKIPVDGVVIEGESYVDESMITGEPIPNLKKKGDEVIGG
TINKNSVLKIEAKRVGGETVLAQIIKLVEEAQNTRPPIQRIADKIVTYFIPVVLTIALLS
FAYWGLIAKQPLIFAFTTLISVLVIACPCAFGMATPTALTVGMGKGAEMGILIKNGEVLE
IARKATVVLFDKTGTLTKGRPEVTDIITFGMDEKELLKLVASAEKRSEHPLGEAIVRKAQ
ELGIEVVDPEEFEAVTGKGIKAKVNGKEILAGNRKLLKENGYSIENVEEILHKLEDEAKT
AIIVAIDGKIVGVIGIADTIKEHAKEAIEELHRMGKKVGMITGDNRRTANAIAKQLNIDY
VLAEVLPQDKANEVKKLQEKGEVVIFVGDGINDAPALAQADIGIAVSSGTDIAMESGEIV
LMRNDIRDVVKAIKLSQKTLSKIKQNFFWAMIYNIILIPIAAGFAYVLFGVTFQPEWAAG
AMSLSSVSVVTNSLMLKRVRV
Download sequence
Identical sequences H3ZMU2
WP_004068012.1.73549 gi|530548999|ref|YP_008429547.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]