SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|387780207|ref|YP_005755005.1| from Staphylococcus aureus subsp. aureus LGA251

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|387780207|ref|YP_005755005.1|
Domain Number 1 Region: 3-192
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 2e-64
Family Branched-chain alpha-keto acid dehydrogenase Pyr module 0.0000000762
Further Details:      
 
Domain Number 2 Region: 188-324
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 8.38e-41
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.00000522
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|387780207|ref|YP_005755005.1|
Sequence length 325
Comment putative pyruvate dehydrogenase E1 component,beta subunit [Staphylococcus aureus subsp. aureus LGA251]
Sequence
MAQMTMVQAINDALKTELKNDQDVLIFGEDVGVNGGVFRVTEGLQKEFGEDRVFDTPLAE
SGIGGLAMGLAVEGFRPVMEVQFLGFVFEVFDAIAGQIARTRFRSGGTKTAPVTIRSPFG
GGVHTPELHADNLEGILAQSPGLKVVIPSGPYDAKGLLISSIRSNDPVVYLEHMKLYRSF
REEVPEEEYTIDIGKANVKKEGNDISIITYGAMVQESMKAAEELEKDGYSVEVIDLRTVQ
PIDVDTIVASVEKTGRAVVVQEAQRQAGVGAAVVAELSERAILSLEAPIGRVAAADTIYP
FTQAENVWLPNKNDIIEKAKETLEF
Download sequence
Identical sequences A0A0D1H2F2 A0A0E0VNQ3 A0A0E1AJS5 A0A0E1VID8 A0A0E1XH27 A0A0H2XFH8 A0A0H3K828 A0A1E8WQ66 A0A2H5AMY6 P0A0A1 P0A0A2 P0A0A3 P99063 Q2G2A5 Q6GAC0 Q6GHZ1 T1Y7B9 W8TZY6
gi|269202705|ref|YP_003281974.1| gi|387602367|ref|YP_005733888.1| gi|387142706|ref|YP_005731099.1| gi|384864321|ref|YP_005749680.1| gi|532359122|ref|YP_008448951.1| gi|537442427|ref|YP_008485004.1| gi|384868024|ref|YP_005748220.1| gi|386830630|ref|YP_006237284.1| gi|15924084|ref|NP_371618.1| gi|161509277|ref|YP_001574936.1| jgi|Aspzo1|152588|fgenesh1_pm.9_#_80 gi|150393642|ref|YP_001316317.1| gi|49483257|ref|YP_040481.1| WP_000068176.1.100013 WP_000068176.1.100041 WP_000068176.1.100049 WP_000068176.1.100057 WP_000068176.1.10006 WP_000068176.1.100067 WP_000068176.1.100072 WP_000068176.1.100075 WP_000068176.1.100084 WP_000068176.1.100088 WP_000068176.1.100090 WP_000068176.1.100094 WP_000068176.1.100096 WP_000068176.1.100117 WP_000068176.1.100122 WP_000068176.1.10014 WP_000068176.1.100154 WP_000068176.1.100171 WP_000068176.1.100180 WP_000068176.1.100184 WP_000068176.1.100189 WP_000068176.1.100235 WP_000068176.1.100265 WP_000068176.1.100272 WP_000068176.1.100298 WP_000068176.1.100307 WP_000068176.1.100310 WP_000068176.1.10032 WP_000068176.1.100335 WP_000068176.1.100347 WP_000068176.1.100352 WP_000068176.1.100357 WP_000068176.1.100366 WP_000068176.1.100384 WP_000068176.1.100391 WP_000068176.1.100399 WP_000068176.1.10041 WP_000068176.1.100452 WP_000068176.1.100464 WP_000068176.1.10050 WP_000068176.1.100507 WP_000068176.1.100527 WP_000068176.1.10053 WP_000068176.1.100534 WP_000068176.1.100535 WP_000068176.1.100551 WP_000068176.1.100560 WP_000068176.1.100562 WP_000068176.1.100582 WP_000068176.1.100596 WP_000068176.1.100604 WP_000068176.1.100612 WP_000068176.1.100613 WP_000068176.1.100618 WP_000068176.1.100631 WP_000068176.1.100647 WP_000068176.1.100665 WP_000068176.1.100668 WP_000068176.1.100678 WP_000068176.1.100693 WP_000068176.1.100699 WP_000068176.1.100704 WP_000068176.1.100719 WP_000068176.1.100726 WP_000068176.1.100761 WP_000068176.1.100768 WP_000068176.1.100785 WP_000068176.1.100823 WP_000068176.1.100834 WP_000068176.1.10085 WP_000068176.1.100860 WP_000068176.1.100888 WP_000068176.1.1009 WP_000068176.1.100903 WP_000068176.1.100920 WP_000068176.1.100922 WP_000068176.1.100934 WP_000068176.1.100956 WP_000068176.1.100963 WP_000068176.1.10097 WP_000068176.1.100981 WP_000068176.1.100986 WP_000068176.1.100987 WP_000068176.1.101002 WP_000068176.1.101017 WP_000068176.1.101019 WP_000068176.1.101023 WP_000068176.1.101027 WP_000068176.1.101055 WP_000068176.1.101068 WP_000068176.1.101071 WP_000068176.1.101072 WP_000068176.1.101084 WP_000068176.1.101103 WP_000068176.1.10111 WP_000068176.1.101142 WP_000068176.1.101160 WP_000068176.1.101177 WP_000068176.1.101192 WP_000068176.1.101217 WP_000068176.1.101240 WP_000068176.1.101262 WP_000068176.1.101266 WP_000068176.1.101298 WP_000068176.1.101327 WP_000068176.1.101329 WP_000068176.1.101330 WP_000068176.1.101352 WP_000068176.1.101355 WP_000068176.1.101375 WP_000068176.1.101379 WP_000068176.1.101393 WP_000068176.1.101397 WP_000068176.1.101402 WP_000068176.1.101406 WP_000068176.1.101414 WP_000068176.1.101440 WP_000068176.1.101441 WP_000068176.1.101458 WP_000068176.1.10148 WP_000068176.1.101490 WP_000068176.1.101495 WP_000068176.1.1015 WP_000068176.1.101505 WP_000068176.1.101511 WP_000068176.1.101531 WP_000068176.1.101566 WP_000068176.1.101567 WP_000068176.1.101570 WP_000068176.1.101598 WP_000068176.1.101615 WP_000068176.1.101617 WP_000068176.1.101619 WP_000068176.1.101627 WP_000068176.1.101645 WP_000068176.1.10165 WP_000068176.1.101657 WP_000068176.1.10166 WP_000068176.1.101661 WP_000068176.1.101670 WP_000068176.1.101691 WP_000068176.1.101704 WP_000068176.1.101716 WP_000068176.1.101725 WP_000068176.1.101728 WP_000068176.1.101731 WP_000068176.1.101757 WP_000068176.1.101758 WP_000068176.1.101775 WP_000068176.1.101778 WP_000068176.1.101779 WP_000068176.1.101788 WP_000068176.1.101813 WP_000068176.1.101820 WP_000068176.1.101821 WP_000068176.1.101824 WP_000068176.1.101825 WP_000068176.1.101831 WP_000068176.1.101852 WP_000068176.1.101902 WP_000068176.1.101906 WP_000068176.1.101921 WP_000068176.1.101922 WP_000068176.1.101943 WP_000068176.1.101950 WP_000068176.1.101999 WP_000068176.1.102066 WP_000068176.1.102070 WP_000068176.1.102084 WP_000068176.1.10209 WP_000068176.1.102096 WP_000068176.1.102123 WP_000068176.1.102126 WP_000068176.1.102130 WP_000068176.1.102132 WP_000068176.1.10214 WP_000068176.1.1022 WP_000068176.1.10232 WP_000068176.1.10238 WP_000068176.1.10240 WP_000068176.1.10244 WP_000068176.1.10249 WP_000068176.1.1025 WP_000068176.1.10274 WP_000068176.1.10292 WP_000068176.1.10294 WP_000068176.1.10301 WP_000068176.1.10306 WP_000068176.1.10308 WP_000068176.1.1031 WP_000068176.1.1032 WP_000068176.1.10321 WP_000068176.1.10343 WP_000068176.1.10355 WP_000068176.1.10358 WP_000068176.1.10397 WP_000068176.1.10408 WP_000068176.1.1043 WP_000068176.1.10431 WP_000068176.1.10436 WP_000068176.1.10450 WP_000068176.1.10469 WP_000068176.1.10478 WP_000068176.1.10481 WP_000068176.1.10486 WP_000068176.1.10503 WP_000068176.1.1052 WP_000068176.1.10526 WP_000068176.1.10542 WP_000068176.1.10543 WP_000068176.1.10565 WP_000068176.1.10583 WP_000068176.1.1060 WP_000068176.1.10614 WP_000068176.1.10624 WP_000068176.1.10644 WP_000068176.1.10664 WP_000068176.1.10679 WP_000068176.1.10707 WP_000068176.1.10726 WP_000068176.1.10742 WP_000068176.1.10749 WP_000068176.1.10751 WP_000068176.1.1077 WP_000068176.1.10783 WP_000068176.1.10785 WP_000068176.1.10823 WP_000068176.1.10841 WP_000068176.1.10843 WP_000068176.1.10858 WP_000068176.1.1087 WP_000068176.1.10917 WP_000068176.1.10919 WP_000068176.1.10928 WP_000068176.1.10942 WP_000068176.1.10950 WP_000068176.1.10965 WP_000068176.1.10969 WP_000068176.1.1097 WP_000068176.1.10976 WP_000068176.1.10979 WP_000068176.1.10985 WP_000068176.1.10986 WP_000068176.1.11001 WP_000068176.1.11067 WP_000068176.1.11069 WP_000068176.1.11073 WP_000068176.1.11074 WP_000068176.1.11076 WP_000068176.1.11083 WP_000068176.1.11129 WP_000068176.1.1115 WP_000068176.1.11162 WP_000068176.1.11184 WP_000068176.1.11188 WP_000068176.1.1120 WP_000068176.1.11202 WP_000068176.1.11220 WP_000068176.1.11223 WP_000068176.1.11228 WP_000068176.1.11234 WP_000068176.1.1124 WP_000068176.1.11261 WP_000068176.1.11281 WP_000068176.1.11286 WP_000068176.1.11287 WP_000068176.1.11294 WP_000068176.1.11312 WP_000068176.1.11322 WP_000068176.1.11333 WP_000068176.1.11348 WP_000068176.1.11353 WP_000068176.1.1136 WP_000068176.1.11365 WP_000068176.1.11377 WP_000068176.1.11378 WP_000068176.1.11391 WP_000068176.1.11403 WP_000068176.1.11407 WP_000068176.1.11434 WP_000068176.1.11441 WP_000068176.1.11447 WP_000068176.1.11451 WP_000068176.1.11463 WP_000068176.1.1147 WP_000068176.1.11475 WP_000068176.1.11488 WP_000068176.1.11492 WP_000068176.1.11494 WP_000068176.1.11504 WP_000068176.1.1151 WP_000068176.1.11513 WP_000068176.1.1152 WP_000068176.1.11525 WP_000068176.1.11540 WP_000068176.1.11556 WP_000068176.1.11558 WP_000068176.1.11571 WP_000068176.1.11580 WP_000068176.1.11592 WP_000068176.1.11611 WP_000068176.1.11625 WP_000068176.1.11640 WP_000068176.1.11646 WP_000068176.1.11660 WP_000068176.1.11663 WP_000068176.1.11665 WP_000068176.1.11692 WP_000068176.1.117 WP_000068176.1.1171 WP_000068176.1.11719 WP_000068176.1.11720 WP_000068176.1.11723 WP_000068176.1.11730 WP_000068176.1.11736 WP_000068176.1.11741 WP_000068176.1.11768 WP_000068176.1.11781 WP_000068176.1.11794 WP_000068176.1.11795 WP_000068176.1.11816 WP_000068176.1.11828 WP_000068176.1.11829 WP_000068176.1.11837 WP_000068176.1.11884 WP_000068176.1.11894 WP_000068176.1.11903 WP_000068176.1.11904 WP_000068176.1.11919 WP_000068176.1.11969 WP_000068176.1.11991 WP_000068176.1.12005 WP_000068176.1.12019 WP_000068176.1.12026 WP_000068176.1.12029 WP_000068176.1.1205 WP_000068176.1.12073 WP_000068176.1.12098 WP_000068176.1.1210 WP_000068176.1.12123 WP_000068176.1.1213 WP_000068176.1.12137 WP_000068176.1.12149 WP_000068176.1.12152 WP_000068176.1.12158 WP_000068176.1.12170 WP_000068176.1.12175 WP_000068176.1.12179 WP_000068176.1.12181 WP_000068176.1.12193 WP_000068176.1.12194 WP_000068176.1.12201 WP_000068176.1.12226 WP_000068176.1.12233 WP_000068176.1.12234 WP_000068176.1.12256 WP_000068176.1.12272 WP_000068176.1.12297 WP_000068176.1.12328 WP_000068176.1.12361 WP_000068176.1.12366 WP_000068176.1.12391 WP_000068176.1.12436 WP_000068176.1.12437 WP_000068176.1.12447 WP_000068176.1.12498 WP_000068176.1.12516 WP_000068176.1.1252 WP_000068176.1.1253 WP_000068176.1.12555 WP_000068176.1.1257 WP_000068176.1.12597 WP_000068176.1.12598 WP_000068176.1.12605 WP_000068176.1.12608 WP_000068176.1.12618 WP_000068176.1.12639 WP_000068176.1.12668 WP_000068176.1.12685 WP_000068176.1.12705 WP_000068176.1.12707 WP_000068176.1.12711 WP_000068176.1.12715 WP_000068176.1.12733 WP_000068176.1.12737 WP_000068176.1.1276 WP_000068176.1.12770 WP_000068176.1.12771 WP_000068176.1.12772 WP_000068176.1.12780 WP_000068176.1.12788 WP_000068176.1.12802 WP_000068176.1.12822 WP_000068176.1.12829 WP_000068176.1.12833 WP_000068176.1.12845 WP_000068176.1.12858 WP_000068176.1.12862 WP_000068176.1.12884 WP_000068176.1.12886 WP_000068176.1.12903 WP_000068176.1.12904 WP_000068176.1.12918 WP_000068176.1.12920 WP_000068176.1.12937 WP_000068176.1.12938 WP_000068176.1.12951 WP_000068176.1.12977 WP_000068176.1.13013 WP_000068176.1.13039 WP_000068176.1.13072 WP_000068176.1.13091 WP_000068176.1.13104 WP_000068176.1.13112 WP_000068176.1.13154 WP_000068176.1.13164 WP_000068176.1.13170 WP_000068176.1.13228 WP_000068176.1.13243 WP_000068176.1.13250 WP_000068176.1.13303 WP_000068176.1.13307 WP_000068176.1.13317 WP_000068176.1.13322 WP_000068176.1.13336 WP_000068176.1.13355 WP_000068176.1.13366 WP_000068176.1.13376 WP_000068176.1.13379 WP_000068176.1.13448 WP_000068176.1.13468 WP_000068176.1.1347 WP_000068176.1.13486 WP_000068176.1.13501 WP_000068176.1.13505 WP_000068176.1.13514 WP_000068176.1.13531 WP_000068176.1.13532 WP_000068176.1.1355 WP_000068176.1.13556 WP_000068176.1.13557 WP_000068176.1.13568 WP_000068176.1.13598 WP_000068176.1.13612 WP_000068176.1.13617 WP_000068176.1.13650 WP_000068176.1.13654 WP_000068176.1.13665 WP_000068176.1.13668 WP_000068176.1.13670 WP_000068176.1.13679 WP_000068176.1.13680 WP_000068176.1.13683 WP_000068176.1.13696 WP_000068176.1.13709 WP_000068176.1.13726 WP_000068176.1.13727 WP_000068176.1.13728 WP_000068176.1.13733 WP_000068176.1.13734 WP_000068176.1.1374 WP_000068176.1.1375 WP_000068176.1.13755 WP_000068176.1.13757 WP_000068176.1.13769 WP_000068176.1.13772 WP_000068176.1.13804 WP_000068176.1.13805 WP_000068176.1.13807 WP_000068176.1.13831 WP_000068176.1.13870 WP_000068176.1.13879 WP_000068176.1.13884 WP_000068176.1.13897 WP_000068176.1.13904 WP_000068176.1.13914 WP_000068176.1.13933 WP_000068176.1.13940 WP_000068176.1.13947 WP_000068176.1.13948 WP_000068176.1.13983 WP_000068176.1.13987 WP_000068176.1.14010 WP_000068176.1.14025 WP_000068176.1.14034 WP_000068176.1.14071 WP_000068176.1.14076 WP_000068176.1.14097 WP_000068176.1.14112 WP_000068176.1.14143 WP_000068176.1.14153 WP_000068176.1.14163 WP_000068176.1.1418 WP_000068176.1.14192 WP_000068176.1.1420 WP_000068176.1.14201 WP_000068176.1.14221 WP_000068176.1.14233 WP_000068176.1.1425 WP_000068176.1.1426 WP_000068176.1.14272 WP_000068176.1.1429 WP_000068176.1.14298 WP_000068176.1.14302 WP_000068176.1.14305 WP_000068176.1.14314 WP_000068176.1.14337 WP_000068176.1.14342 WP_000068176.1.14349 WP_000068176.1.14355 WP_000068176.1.14358 WP_000068176.1.14363 WP_000068176.1.14364 WP_000068176.1.14365 WP_000068176.1.14366 WP_000068176.1.14372 WP_000068176.1.14394 WP_000068176.1.14397 WP_000068176.1.14412 WP_000068176.1.14418 WP_000068176.1.14475 WP_000068176.1.14535 WP_000068176.1.14546 WP_000068176.1.1457 WP_000068176.1.14590 WP_000068176.1.14596 WP_000068176.1.14639 WP_000068176.1.14665 WP_000068176.1.14666 WP_000068176.1.1468 WP_000068176.1.14681 WP_000068176.1.14696 WP_000068176.1.147 WP_000068176.1.1471 WP_000068176.1.14729 WP_000068176.1.14734 WP_000068176.1.14744 WP_000068176.1.14747 WP_000068176.1.1477 WP_000068176.1.14770 WP_000068176.1.14774 WP_000068176.1.14782 WP_000068176.1.14787 WP_000068176.1.14790 WP_000068176.1.14809 WP_000068176.1.14823 WP_000068176.1.14825 WP_000068176.1.14846 WP_000068176.1.14866 WP_000068176.1.14868 WP_000068176.1.14869 WP_000068176.1.14874 WP_000068176.1.14888 WP_000068176.1.1490 WP_000068176.1.14902 WP_000068176.1.14924 WP_000068176.1.14967 WP_000068176.1.14970 WP_000068176.1.14987 WP_000068176.1.15000 WP_000068176.1.15015 WP_000068176.1.15022 WP_000068176.1.15029 WP_000068176.1.15039 WP_000068176.1.15071 WP_000068176.1.15091 WP_000068176.1.15098 WP_000068176.1.15108 WP_000068176.1.15150 WP_000068176.1.15173 WP_000068176.1.15182 WP_000068176.1.15185 WP_000068176.1.1520 WP_000068176.1.15201 WP_000068176.1.15206 WP_000068176.1.15228 WP_000068176.1.15234 WP_000068176.1.15241 WP_000068176.1.1525 WP_000068176.1.15255 WP_000068176.1.15263 WP_000068176.1.15268 WP_000068176.1.15269 WP_000068176.1.15278 WP_000068176.1.15294 WP_000068176.1.15296 WP_000068176.1.15329 WP_000068176.1.15389 WP_000068176.1.15399 WP_000068176.1.15403 WP_000068176.1.15409 WP_000068176.1.15421 WP_000068176.1.15438 WP_000068176.1.1545 WP_000068176.1.15478 WP_000068176.1.15489 WP_000068176.1.15505 WP_000068176.1.15507 WP_000068176.1.15519 WP_000068176.1.15524 WP_000068176.1.15532 WP_000068176.1.15533 WP_000068176.1.15544 WP_000068176.1.15546 WP_000068176.1.15554 WP_000068176.1.15572 WP_000068176.1.1558 WP_000068176.1.15590 WP_000068176.1.15591 WP_000068176.1.15601 WP_000068176.1.1562 WP_000068176.1.1564 WP_000068176.1.15641 WP_000068176.1.15679 WP_000068176.1.15687 WP_000068176.1.15691 WP_000068176.1.15706 WP_000068176.1.15712 WP_000068176.1.15722 WP_000068176.1.15753 WP_000068176.1.15785 WP_000068176.1.1579 WP_000068176.1.15812 WP_000068176.1.15818 WP_000068176.1.15819 WP_000068176.1.1583 WP_000068176.1.15838 WP_000068176.1.1586 WP_000068176.1.15888 WP_000068176.1.15892 WP_000068176.1.15897 WP_000068176.1.15898 WP_000068176.1.159 WP_000068176.1.15920 WP_000068176.1.15925 WP_000068176.1.15928 WP_000068176.1.15939 WP_000068176.1.15948 WP_000068176.1.15957 WP_000068176.1.15972 WP_000068176.1.1599 WP_000068176.1.1600 WP_000068176.1.16018 WP_000068176.1.16026 WP_000068176.1.1606 WP_000068176.1.16068 WP_000068176.1.16083 WP_000068176.1.16095 WP_000068176.1.16096 WP_000068176.1.16098 WP_000068176.1.16112 WP_000068176.1.16114 WP_000068176.1.16140 WP_000068176.1.16157 WP_000068176.1.16173 WP_000068176.1.16195 WP_000068176.1.16203 WP_000068176.1.16213 WP_000068176.1.16214 WP_000068176.1.16223 WP_000068176.1.1623 WP_000068176.1.16237 WP_000068176.1.16251 WP_000068176.1.16276 WP_000068176.1.16283 WP_000068176.1.16311 WP_000068176.1.16362 WP_000068176.1.16372 WP_000068176.1.16395 WP_000068176.1.16399 WP_000068176.1.16407 WP_000068176.1.16408 WP_000068176.1.16414 WP_000068176.1.16417 WP_000068176.1.16433 WP_000068176.1.16436 WP_000068176.1.16455 WP_000068176.1.16458 WP_000068176.1.16467 WP_000068176.1.16478 WP_000068176.1.16554 WP_000068176.1.16564 WP_000068176.1.16569 WP_000068176.1.16589 WP_000068176.1.16603 WP_000068176.1.16606 WP_000068176.1.16617 WP_000068176.1.1662 WP_000068176.1.16628 WP_000068176.1.16632 WP_000068176.1.16639 WP_000068176.1.16649 WP_000068176.1.1665 WP_000068176.1.16651 WP_000068176.1.16653 WP_000068176.1.16664 WP_000068176.1.16672 WP_000068176.1.16679 WP_000068176.1.16684 WP_000068176.1.16688 WP_000068176.1.16693 WP_000068176.1.16703 WP_000068176.1.16747 WP_000068176.1.16757 WP_000068176.1.16761 WP_000068176.1.16762 WP_000068176.1.16768 WP_000068176.1.16770 WP_000068176.1.16776 WP_000068176.1.16794 WP_000068176.1.16802 WP_000068176.1.16815 WP_000068176.1.16824 WP_000068176.1.16833 WP_000068176.1.16880 WP_000068176.1.16892 WP_000068176.1.16920 WP_000068176.1.16925 WP_000068176.1.16936 WP_000068176.1.16938 WP_000068176.1.16946 WP_000068176.1.16969 WP_000068176.1.16986 WP_000068176.1.170 WP_000068176.1.17009 WP_000068176.1.17012 WP_000068176.1.17038 WP_000068176.1.17050 WP_000068176.1.17080 WP_000068176.1.17104 WP_000068176.1.17122 WP_000068176.1.17132 WP_000068176.1.17137 WP_000068176.1.17139 WP_000068176.1.17143 WP_000068176.1.17156 WP_000068176.1.17157 WP_000068176.1.17176 WP_000068176.1.17180 WP_000068176.1.17193 WP_000068176.1.17200 WP_000068176.1.17201 WP_000068176.1.17231 WP_000068176.1.17234 WP_000068176.1.17240 WP_000068176.1.17248 WP_000068176.1.17249 WP_000068176.1.1725 WP_000068176.1.17256 WP_000068176.1.17289 WP_000068176.1.1729 WP_000068176.1.17296 WP_000068176.1.17309 WP_000068176.1.17320 WP_000068176.1.17327 WP_000068176.1.1736 WP_000068176.1.1740 WP_000068176.1.1741 WP_000068176.1.17419 WP_000068176.1.17450 WP_000068176.1.17454 WP_000068176.1.17456 WP_000068176.1.17475 WP_000068176.1.17485 WP_000068176.1.1751 WP_000068176.1.17520 WP_000068176.1.17524 WP_000068176.1.17526 WP_000068176.1.17529 WP_000068176.1.17531 WP_000068176.1.1756 WP_000068176.1.17569 WP_000068176.1.17581 WP_000068176.1.17590 WP_000068176.1.17628 WP_000068176.1.17643 WP_000068176.1.1765 WP_000068176.1.17650 WP_000068176.1.17651 WP_000068176.1.17657 WP_000068176.1.17658 WP_000068176.1.17666 WP_000068176.1.17671 WP_000068176.1.17676 WP_000068176.1.1771 WP_000068176.1.17717 WP_000068176.1.17718 WP_000068176.1.17720 WP_000068176.1.17725 WP_000068176.1.17729 WP_000068176.1.17737 WP_000068176.1.17770 WP_000068176.1.17796 WP_000068176.1.17818 WP_000068176.1.17832 WP_000068176.1.17834 WP_000068176.1.17835 WP_000068176.1.17838 WP_000068176.1.17845 WP_000068176.1.17847 WP_000068176.1.17853 WP_000068176.1.17859 WP_000068176.1.1787 WP_000068176.1.17876 WP_000068176.1.17882 WP_000068176.1.17909 WP_000068176.1.17928 WP_000068176.1.17929 WP_000068176.1.17943 WP_000068176.1.17951 WP_000068176.1.17966 WP_000068176.1.17974 WP_000068176.1.17987 WP_000068176.1.18011 WP_000068176.1.18016 WP_000068176.1.18035 WP_000068176.1.18043 WP_000068176.1.18069 WP_000068176.1.18074 WP_000068176.1.18080 WP_000068176.1.18105 WP_000068176.1.1811 WP_000068176.1.18113 WP_000068176.1.18132 WP_000068176.1.18140 WP_000068176.1.18153 WP_000068176.1.18197 WP_000068176.1.18203 WP_000068176.1.18237 WP_000068176.1.18248 WP_000068176.1.18261 WP_000068176.1.18273 WP_000068176.1.18283 WP_000068176.1.18288 WP_000068176.1.1829 WP_000068176.1.18290 WP_000068176.1.18301 WP_000068176.1.18309 WP_000068176.1.18310 WP_000068176.1.18320 WP_000068176.1.1835 WP_000068176.1.18360 WP_000068176.1.18412 WP_000068176.1.18424 WP_000068176.1.18429 WP_000068176.1.18437 WP_000068176.1.18451 WP_000068176.1.18466 WP_000068176.1.1847 WP_000068176.1.18487 WP_000068176.1.1849 WP_000068176.1.18495 WP_000068176.1.18497 WP_000068176.1.185 WP_000068176.1.18504 WP_000068176.1.18506 WP_000068176.1.18507 WP_000068176.1.1851 WP_000068176.1.18516 WP_000068176.1.18526 WP_000068176.1.18527 WP_000068176.1.18529 WP_000068176.1.18538 WP_000068176.1.18539 WP_000068176.1.18545 WP_000068176.1.18562 WP_000068176.1.18566 WP_000068176.1.18567 WP_000068176.1.18570 WP_000068176.1.18590 WP_000068176.1.18591 WP_000068176.1.18605 WP_000068176.1.18611 WP_000068176.1.18627 WP_000068176.1.18632 WP_000068176.1.18656 WP_000068176.1.18658 WP_000068176.1.18668 WP_000068176.1.18679 WP_000068176.1.18719 WP_000068176.1.18741 WP_000068176.1.18758 WP_000068176.1.18763 WP_000068176.1.18774 WP_000068176.1.18777 WP_000068176.1.18779 WP_000068176.1.18792 WP_000068176.1.18799 WP_000068176.1.18809 WP_000068176.1.18818 WP_000068176.1.18830 WP_000068176.1.18834 WP_000068176.1.18836 WP_000068176.1.18870 WP_000068176.1.18879 WP_000068176.1.18882 WP_000068176.1.18918 WP_000068176.1.1892 WP_000068176.1.18938 WP_000068176.1.18963 WP_000068176.1.18965 WP_000068176.1.18968 WP_000068176.1.18974 WP_000068176.1.18987 WP_000068176.1.18996 WP_000068176.1.19009 WP_000068176.1.1901 WP_000068176.1.19014 WP_000068176.1.19022 WP_000068176.1.19027 WP_000068176.1.19052 WP_000068176.1.19082 WP_000068176.1.19102 WP_000068176.1.19109 WP_000068176.1.1911 WP_000068176.1.1912 WP_000068176.1.19149 WP_000068176.1.19179 WP_000068176.1.192 WP_000068176.1.1921 WP_000068176.1.19259 WP_000068176.1.19272 WP_000068176.1.19301 WP_000068176.1.19306 WP_000068176.1.19322 WP_000068176.1.19365 WP_000068176.1.19370 WP_000068176.1.19375 WP_000068176.1.19377 WP_000068176.1.19386 WP_000068176.1.19390 WP_000068176.1.19399 WP_000068176.1.1940 WP_000068176.1.19411 WP_000068176.1.1943 WP_000068176.1.19430 WP_000068176.1.19444 WP_000068176.1.19455 WP_000068176.1.19497 WP_000068176.1.19509 WP_000068176.1.19515 WP_000068176.1.19537 WP_000068176.1.19555 WP_000068176.1.19575 WP_000068176.1.19577 WP_000068176.1.19611 WP_000068176.1.1962 WP_000068176.1.1964 WP_000068176.1.19643 WP_000068176.1.19653 WP_000068176.1.19700 WP_000068176.1.19701 WP_000068176.1.19717 WP_000068176.1.19732 WP_000068176.1.19733 WP_000068176.1.1974 WP_000068176.1.19748 WP_000068176.1.1975 WP_000068176.1.19759 WP_000068176.1.19765 WP_000068176.1.19775 WP_000068176.1.19788 WP_000068176.1.19792 WP_000068176.1.19801 WP_000068176.1.19807 WP_000068176.1.19816 WP_000068176.1.19848 WP_000068176.1.19853 WP_000068176.1.19881 WP_000068176.1.19891 WP_000068176.1.19904 WP_000068176.1.19905 WP_000068176.1.19912 WP_000068176.1.19921 WP_000068176.1.19968 WP_000068176.1.19977 WP_000068176.1.19980 WP_000068176.1.19981 WP_000068176.1.19982 WP_000068176.1.2 WP_000068176.1.20006 WP_000068176.1.20049 WP_000068176.1.20052 WP_000068176.1.20057 WP_000068176.1.2007 WP_000068176.1.20078 WP_000068176.1.2008 WP_000068176.1.20090 WP_000068176.1.20100 WP_000068176.1.20101 WP_000068176.1.2013 WP_000068176.1.20155 WP_000068176.1.20160 WP_000068176.1.20161 WP_000068176.1.20167 WP_000068176.1.20177 WP_000068176.1.20191 WP_000068176.1.20201 WP_000068176.1.20210 WP_000068176.1.20214 WP_000068176.1.20219 WP_000068176.1.20221 WP_000068176.1.20235 WP_000068176.1.20245 WP_000068176.1.2025 WP_000068176.1.20265 WP_000068176.1.2029 WP_000068176.1.20307 WP_000068176.1.20324 WP_000068176.1.20340 WP_000068176.1.20354 WP_000068176.1.20358 WP_000068176.1.20386 WP_000068176.1.20394 WP_000068176.1.20398 WP_000068176.1.20399 WP_000068176.1.20411 WP_000068176.1.20447 WP_000068176.1.20473 WP_000068176.1.20479 WP_000068176.1.20487 WP_000068176.1.20496 WP_000068176.1.20500 WP_000068176.1.20512 WP_000068176.1.20550 WP_000068176.1.20554 WP_000068176.1.20558 WP_000068176.1.2056 WP_000068176.1.20574 WP_000068176.1.20579 WP_000068176.1.20585 WP_000068176.1.20598 WP_000068176.1.20611 WP_000068176.1.20618 WP_000068176.1.20619 WP_000068176.1.20620 WP_000068176.1.20649 WP_000068176.1.20661 WP_000068176.1.20690 WP_000068176.1.20698 WP_000068176.1.20736 WP_000068176.1.20772 WP_000068176.1.2079 WP_000068176.1.20796 WP_000068176.1.20821 WP_000068176.1.20833 WP_000068176.1.20838 WP_000068176.1.20846 WP_000068176.1.20860 WP_000068176.1.20866 WP_000068176.1.20867 WP_000068176.1.20878 WP_000068176.1.20906 WP_000068176.1.20913 WP_000068176.1.20922 WP_000068176.1.20935 WP_000068176.1.20939 WP_000068176.1.20945 WP_000068176.1.20971 WP_000068176.1.20975 WP_000068176.1.20979 WP_000068176.1.21013 WP_000068176.1.21015 WP_000068176.1.21031 WP_000068176.1.21036 WP_000068176.1.21054 WP_000068176.1.21056 WP_000068176.1.21064 WP_000068176.1.21066 WP_000068176.1.21078 WP_000068176.1.21080 WP_000068176.1.21081 WP_000068176.1.21102 WP_000068176.1.21109 WP_000068176.1.21111 WP_000068176.1.21140 WP_000068176.1.21154 WP_000068176.1.21183 WP_000068176.1.2119 WP_000068176.1.21222 WP_000068176.1.21257 WP_000068176.1.21259 WP_000068176.1.21272 WP_000068176.1.2128 WP_000068176.1.2129 WP_000068176.1.21312 WP_000068176.1.21313 WP_000068176.1.21314 WP_000068176.1.21330 WP_000068176.1.21339 WP_000068176.1.2135 WP_000068176.1.21356 WP_000068176.1.21359 WP_000068176.1.21375 WP_000068176.1.21379 WP_000068176.1.21386 WP_000068176.1.21393 WP_000068176.1.21402 WP_000068176.1.21412 WP_000068176.1.21416 WP_000068176.1.21458 WP_000068176.1.21464 WP_000068176.1.21465 WP_000068176.1.21477 WP_000068176.1.21480 WP_000068176.1.21500 WP_000068176.1.21505 WP_000068176.1.21511 WP_000068176.1.21514 WP_000068176.1.2154 WP_000068176.1.21572 WP_000068176.1.21583 WP_000068176.1.21589 WP_000068176.1.2159 WP_000068176.1.2160 WP_000068176.1.21601 WP_000068176.1.21621 WP_000068176.1.21636 WP_000068176.1.21679 WP_000068176.1.21712 WP_000068176.1.21719 WP_000068176.1.21724 WP_000068176.1.21746 WP_000068176.1.21763 WP_000068176.1.2178 WP_000068176.1.21787 WP_000068176.1.21820 WP_000068176.1.21828 WP_000068176.1.21830 WP_000068176.1.21890 WP_000068176.1.21894 WP_000068176.1.21900 WP_000068176.1.21901 WP_000068176.1.21919 WP_000068176.1.21954 WP_000068176.1.21985 WP_000068176.1.21988 WP_000068176.1.2200 WP_000068176.1.22000 WP_000068176.1.22011 WP_000068176.1.22022 WP_000068176.1.22027 WP_000068176.1.22033 WP_000068176.1.22038 WP_000068176.1.22045 WP_000068176.1.22049 WP_000068176.1.22065 WP_000068176.1.22082 WP_000068176.1.22093 WP_000068176.1.2211 WP_000068176.1.22111 WP_000068176.1.22149 WP_000068176.1.22163 WP_000068176.1.22164 WP_000068176.1.22165 WP_000068176.1.22170 WP_000068176.1.22174 WP_000068176.1.22177 WP_000068176.1.22180 WP_000068176.1.22197 WP_000068176.1.22200 WP_000068176.1.22227 WP_000068176.1.22246 WP_000068176.1.22259 WP_000068176.1.22302 WP_000068176.1.22307 WP_000068176.1.22332 WP_000068176.1.22344 WP_000068176.1.22351 WP_000068176.1.22367 WP_000068176.1.22369 WP_000068176.1.22400 WP_000068176.1.22418 WP_000068176.1.22419 WP_000068176.1.22426 WP_000068176.1.22441 WP_000068176.1.22493 WP_000068176.1.22498 WP_000068176.1.22512 WP_000068176.1.22526 WP_000068176.1.22531 WP_000068176.1.22533 WP_000068176.1.22547 WP_000068176.1.22551 WP_000068176.1.22559 WP_000068176.1.22650 WP_000068176.1.22657 WP_000068176.1.22684 WP_000068176.1.22696 WP_000068176.1.22702 WP_000068176.1.22709 WP_000068176.1.22714 WP_000068176.1.22727 WP_000068176.1.22730 WP_000068176.1.22731 WP_000068176.1.22738 WP_000068176.1.22739 WP_000068176.1.22764 WP_000068176.1.22789 WP_000068176.1.22790 WP_000068176.1.22792 WP_000068176.1.2280 WP_000068176.1.22803 WP_000068176.1.22808 WP_000068176.1.22811 WP_000068176.1.22826 WP_000068176.1.22843 WP_000068176.1.22853 WP_000068176.1.22859 WP_000068176.1.22861 WP_000068176.1.22869 WP_000068176.1.22890 WP_000068176.1.22975 WP_000068176.1.22983 WP_000068176.1.22984 WP_000068176.1.22994 WP_000068176.1.23004 WP_000068176.1.23008 WP_000068176.1.23012 WP_000068176.1.23048 WP_000068176.1.23061 WP_000068176.1.23069 WP_000068176.1.23082 WP_000068176.1.23103 WP_000068176.1.23121 WP_000068176.1.23130 WP_000068176.1.23132 WP_000068176.1.23133 WP_000068176.1.23146 WP_000068176.1.23152 WP_000068176.1.23185 WP_000068176.1.23194 WP_000068176.1.23197 WP_000068176.1.23217 WP_000068176.1.23222 WP_000068176.1.23228 WP_000068176.1.23238 WP_000068176.1.23244 WP_000068176.1.23251 WP_000068176.1.2327 WP_000068176.1.23275 WP_000068176.1.23288 WP_000068176.1.23304 WP_000068176.1.23381 WP_000068176.1.23413 WP_000068176.1.23420 WP_000068176.1.23431 WP_000068176.1.23439 WP_000068176.1.23449 WP_000068176.1.23450 WP_000068176.1.23476 WP_000068176.1.23489 WP_000068176.1.23491 WP_000068176.1.23516 WP_000068176.1.23517 WP_000068176.1.23531 WP_000068176.1.23541 WP_000068176.1.23544 WP_000068176.1.23557 WP_000068176.1.23568 WP_000068176.1.23572 WP_000068176.1.23580 WP_000068176.1.23586 WP_000068176.1.23613 WP_000068176.1.23617 WP_000068176.1.23626 WP_000068176.1.23644 WP_000068176.1.2365 WP_000068176.1.23671 WP_000068176.1.23690 WP_000068176.1.23708 WP_000068176.1.23710 WP_000068176.1.23730 WP_000068176.1.23740 WP_000068176.1.23796 WP_000068176.1.23809 WP_000068176.1.2382 WP_000068176.1.23822 WP_000068176.1.23842 WP_000068176.1.23849 WP_000068176.1.23856 WP_000068176.1.2389 WP_000068176.1.23896 WP_000068176.1.23900 WP_000068176.1.23902 WP_000068176.1.23907 WP_000068176.1.23926 WP_000068176.1.23935 WP_000068176.1.23944 WP_000068176.1.23956 WP_000068176.1.23972 WP_000068176.1.23995 WP_000068176.1.23998 WP_000068176.1.24000 WP_000068176.1.24081 WP_000068176.1.24148 WP_000068176.1.24154 WP_000068176.1.24167 WP_000068176.1.24174 WP_000068176.1.2420 WP_000068176.1.24207 WP_000068176.1.24213 WP_000068176.1.24226 WP_000068176.1.2423 WP_000068176.1.24241 WP_000068176.1.24263 WP_000068176.1.2427 WP_000068176.1.24275 WP_000068176.1.24276 WP_000068176.1.24277 WP_000068176.1.24279 WP_000068176.1.24286 WP_000068176.1.24302 WP_000068176.1.2434 WP_000068176.1.24343 WP_000068176.1.24347 WP_000068176.1.24364 WP_000068176.1.24365 WP_000068176.1.24388 WP_000068176.1.24416 WP_000068176.1.24418 WP_000068176.1.2442 WP_000068176.1.24436 WP_000068176.1.24437 WP_000068176.1.24439 WP_000068176.1.24443 WP_000068176.1.24462 WP_000068176.1.24469 WP_000068176.1.24478 WP_000068176.1.2450 WP_000068176.1.24502 WP_000068176.1.24503 WP_000068176.1.24516 WP_000068176.1.24519 WP_000068176.1.24569 WP_000068176.1.24572 WP_000068176.1.2458 WP_000068176.1.24589 WP_000068176.1.24596 WP_000068176.1.24597 WP_000068176.1.24602 WP_000068176.1.24617 WP_000068176.1.24625 WP_000068176.1.24631 WP_000068176.1.24644 WP_000068176.1.24654 WP_000068176.1.24674 WP_000068176.1.24679 WP_000068176.1.24681 WP_000068176.1.24684 WP_000068176.1.24685 WP_000068176.1.24702 WP_000068176.1.24711 WP_000068176.1.24714 WP_000068176.1.24745 WP_000068176.1.24780 WP_000068176.1.24781 WP_000068176.1.24802 WP_000068176.1.24817 WP_000068176.1.24823 WP_000068176.1.24834 WP_000068176.1.24855 WP_000068176.1.24856 WP_000068176.1.24891 WP_000068176.1.24903 WP_000068176.1.24918 WP_000068176.1.24937 WP_000068176.1.2497 WP_000068176.1.24996 WP_000068176.1.25001 WP_000068176.1.2501 WP_000068176.1.25012 WP_000068176.1.25029 WP_000068176.1.2506 WP_000068176.1.25070 WP_000068176.1.25083 WP_000068176.1.25092 WP_000068176.1.25095 WP_000068176.1.25098 WP_000068176.1.25115 WP_000068176.1.25117 WP_000068176.1.25120 WP_000068176.1.25145 WP_000068176.1.25167 WP_000068176.1.25170 WP_000068176.1.25187 WP_000068176.1.25209 WP_000068176.1.25216 WP_000068176.1.2522 WP_000068176.1.25221 WP_000068176.1.25262 WP_000068176.1.25287 WP_000068176.1.25288 WP_000068176.1.25331 WP_000068176.1.25341 WP_000068176.1.25345 WP_000068176.1.25361 WP_000068176.1.25433 WP_000068176.1.25438 WP_000068176.1.2544 WP_000068176.1.25459 WP_000068176.1.25469 WP_000068176.1.25479 WP_000068176.1.25488 WP_000068176.1.25489 WP_000068176.1.25495 WP_000068176.1.2552 WP_000068176.1.25557 WP_000068176.1.25567 WP_000068176.1.25569 WP_000068176.1.25591 WP_000068176.1.25593 WP_000068176.1.25595 WP_000068176.1.25597 WP_000068176.1.25623 WP_000068176.1.25634 WP_000068176.1.25651 WP_000068176.1.257 WP_000068176.1.25721 WP_000068176.1.25732 WP_000068176.1.25737 WP_000068176.1.25744 WP_000068176.1.25758 WP_000068176.1.25770 WP_000068176.1.25776 WP_000068176.1.25779 WP_000068176.1.2579 WP_000068176.1.25801 WP_000068176.1.25802 WP_000068176.1.25820 WP_000068176.1.25840 WP_000068176.1.25852 WP_000068176.1.25856 WP_000068176.1.25857 WP_000068176.1.25867 WP_000068176.1.25868 WP_000068176.1.25881 WP_000068176.1.25891 WP_000068176.1.2590 WP_000068176.1.25910 WP_000068176.1.2592 WP_000068176.1.25924 WP_000068176.1.25929 WP_000068176.1.2593 WP_000068176.1.25930 WP_000068176.1.25955 WP_000068176.1.25984 WP_000068176.1.26006 WP_000068176.1.26012 WP_000068176.1.26015 WP_000068176.1.26033 WP_000068176.1.26039 WP_000068176.1.26050 WP_000068176.1.26058 WP_000068176.1.26086 WP_000068176.1.26094 WP_000068176.1.26106 WP_000068176.1.26143 WP_000068176.1.26169 WP_000068176.1.26172 WP_000068176.1.2619 WP_000068176.1.262 WP_000068176.1.2621 WP_000068176.1.26225 WP_000068176.1.26226 WP_000068176.1.26255 WP_000068176.1.26271 WP_000068176.1.26276 WP_000068176.1.26283 WP_000068176.1.26289 WP_000068176.1.26290 WP_000068176.1.26293 WP_000068176.1.26298 WP_000068176.1.26306 WP_000068176.1.26307 WP_000068176.1.26314 WP_000068176.1.26315 WP_000068176.1.26318 WP_000068176.1.2633 WP_000068176.1.26340 WP_000068176.1.26345 WP_000068176.1.26346 WP_000068176.1.26354 WP_000068176.1.26359 WP_000068176.1.26364 WP_000068176.1.26370 WP_000068176.1.26397 WP_000068176.1.26399 WP_000068176.1.26404 WP_000068176.1.26424 WP_000068176.1.2643 WP_000068176.1.26431 WP_000068176.1.2645 WP_000068176.1.26481 WP_000068176.1.26506 WP_000068176.1.26533 WP_000068176.1.2656 WP_000068176.1.2658 WP_000068176.1.26584 WP_000068176.1.2661 WP_000068176.1.26626 WP_000068176.1.2664 WP_000068176.1.26650 WP_000068176.1.26662 WP_000068176.1.26663 WP_000068176.1.26664 WP_000068176.1.26677 WP_000068176.1.26692 WP_000068176.1.26726 WP_000068176.1.2673 WP_000068176.1.26733 WP_000068176.1.26749 WP_000068176.1.26751 WP_000068176.1.26771 WP_000068176.1.26772 WP_000068176.1.26773 WP_000068176.1.26778 WP_000068176.1.26790 WP_000068176.1.2680 WP_000068176.1.26804 WP_000068176.1.2684 WP_000068176.1.26840 WP_000068176.1.26850 WP_000068176.1.26864 WP_000068176.1.26865 WP_000068176.1.2687 WP_000068176.1.26884 WP_000068176.1.26886 WP_000068176.1.2689 WP_000068176.1.26903 WP_000068176.1.26905 WP_000068176.1.26927 WP_000068176.1.26929 WP_000068176.1.26938 WP_000068176.1.26944 WP_000068176.1.26947 WP_000068176.1.26958 WP_000068176.1.26963 WP_000068176.1.2697 WP_000068176.1.27013 WP_000068176.1.27042 WP_000068176.1.27053 WP_000068176.1.27080 WP_000068176.1.27083 WP_000068176.1.27097 WP_000068176.1.2710 WP_000068176.1.27120 WP_000068176.1.27127 WP_000068176.1.27147 WP_000068176.1.27154 WP_000068176.1.27160 WP_000068176.1.27166 WP_000068176.1.27168 WP_000068176.1.27170 WP_000068176.1.2718 WP_000068176.1.27182 WP_000068176.1.2719 WP_000068176.1.27199 WP_000068176.1.27207 WP_000068176.1.27226 WP_000068176.1.27237 WP_000068176.1.27246 WP_000068176.1.2725 WP_000068176.1.27262 WP_000068176.1.27293 WP_000068176.1.27294 WP_000068176.1.27303 WP_000068176.1.27311 WP_000068176.1.27323 WP_000068176.1.27333 WP_000068176.1.2734 WP_000068176.1.27345 WP_000068176.1.27379 WP_000068176.1.27387 WP_000068176.1.27413 WP_000068176.1.27415 WP_000068176.1.2744 WP_000068176.1.27447 WP_000068176.1.27448 WP_000068176.1.27455 WP_000068176.1.27456 WP_000068176.1.27457 WP_000068176.1.27467 WP_000068176.1.27468 WP_000068176.1.27489 WP_000068176.1.27516 WP_000068176.1.27529 WP_000068176.1.2753 WP_000068176.1.27539 WP_000068176.1.27551 WP_000068176.1.27562 WP_000068176.1.2759 WP_000068176.1.27590 WP_000068176.1.27608 WP_000068176.1.27614 WP_000068176.1.27615 WP_000068176.1.27621 WP_000068176.1.27622 WP_000068176.1.27628 WP_000068176.1.27640 WP_000068176.1.27646 WP_000068176.1.27654 WP_000068176.1.27662 WP_000068176.1.27667 WP_000068176.1.27670 WP_000068176.1.27673 WP_000068176.1.2768 WP_000068176.1.27689 WP_000068176.1.27696 WP_000068176.1.27717 WP_000068176.1.27720 WP_000068176.1.27739 WP_000068176.1.27744 WP_000068176.1.27748 WP_000068176.1.27765 WP_000068176.1.27787 WP_000068176.1.27793 WP_000068176.1.27799 WP_000068176.1.27817 WP_000068176.1.27830 WP_000068176.1.27834 WP_000068176.1.27854 WP_000068176.1.27929 WP_000068176.1.2795 WP_000068176.1.27950 WP_000068176.1.27953 WP_000068176.1.27972 WP_000068176.1.27999 WP_000068176.1.2800 WP_000068176.1.28007 WP_000068176.1.28016 WP_000068176.1.28025 WP_000068176.1.28063 WP_000068176.1.28071 WP_000068176.1.28074 WP_000068176.1.28079 WP_000068176.1.2808 WP_000068176.1.28081 WP_000068176.1.28088 WP_000068176.1.28091 WP_000068176.1.28105 WP_000068176.1.28107 WP_000068176.1.28117 WP_000068176.1.28138 WP_000068176.1.28147 WP_000068176.1.28158 WP_000068176.1.28173 WP_000068176.1.28191 WP_000068176.1.28207 WP_000068176.1.28213 WP_000068176.1.28226 WP_000068176.1.28230 WP_000068176.1.28253 WP_000068176.1.28274 WP_000068176.1.28298 WP_000068176.1.28315 WP_000068176.1.28319 WP_000068176.1.28334 WP_000068176.1.28336 WP_000068176.1.28337 WP_000068176.1.28347 WP_000068176.1.28358 WP_000068176.1.28360 WP_000068176.1.28376 WP_000068176.1.28381 WP_000068176.1.28388 WP_000068176.1.28392 WP_000068176.1.28394 WP_000068176.1.28399 WP_000068176.1.2840 WP_000068176.1.28400 WP_000068176.1.28430 WP_000068176.1.28447 WP_000068176.1.28477 WP_000068176.1.28482 WP_000068176.1.28490 WP_000068176.1.28498 WP_000068176.1.28501 WP_000068176.1.28502 WP_000068176.1.2852 WP_000068176.1.28526 WP_000068176.1.28527 WP_000068176.1.28532 WP_000068176.1.28564 WP_000068176.1.28578 WP_000068176.1.28580 WP_000068176.1.28584 WP_000068176.1.28605 WP_000068176.1.28614 WP_000068176.1.2862 WP_000068176.1.28629 WP_000068176.1.28636 WP_000068176.1.28650 WP_000068176.1.28652 WP_000068176.1.28672 WP_000068176.1.28675 WP_000068176.1.28690 WP_000068176.1.28691 WP_000068176.1.28710 WP_000068176.1.28720 WP_000068176.1.28725 WP_000068176.1.28763 WP_000068176.1.28784 WP_000068176.1.28785 WP_000068176.1.28825 WP_000068176.1.28833 WP_000068176.1.28862 WP_000068176.1.28866 WP_000068176.1.28871 WP_000068176.1.28874 WP_000068176.1.28887 WP_000068176.1.28909 WP_000068176.1.2891 WP_000068176.1.28915 WP_000068176.1.28925 WP_000068176.1.28933 WP_000068176.1.28960 WP_000068176.1.28970 WP_000068176.1.28981 WP_000068176.1.29014 WP_000068176.1.29052 WP_000068176.1.2906 WP_000068176.1.29060 WP_000068176.1.29090 WP_000068176.1.29091 WP_000068176.1.29107 WP_000068176.1.29110 WP_000068176.1.29112 WP_000068176.1.2913 WP_000068176.1.29155 WP_000068176.1.29166 WP_000068176.1.29170 WP_000068176.1.29187 WP_000068176.1.29188 WP_000068176.1.29207 WP_000068176.1.29226 WP_000068176.1.29242 WP_000068176.1.29243 WP_000068176.1.29244 WP_000068176.1.29250 WP_000068176.1.29263 WP_000068176.1.29272 WP_000068176.1.29276 WP_000068176.1.29282 WP_000068176.1.29285 WP_000068176.1.29301 WP_000068176.1.29312 WP_000068176.1.29315 WP_000068176.1.29329 WP_000068176.1.29340 WP_000068176.1.29366 WP_000068176.1.29372 WP_000068176.1.29373 WP_000068176.1.29375 WP_000068176.1.29381 WP_000068176.1.29395 WP_000068176.1.29420 WP_000068176.1.29433 WP_000068176.1.29445 WP_000068176.1.29453 WP_000068176.1.29468 WP_000068176.1.29479 WP_000068176.1.29483 WP_000068176.1.29484 WP_000068176.1.29511 WP_000068176.1.29522 WP_000068176.1.29541 WP_000068176.1.29553 WP_000068176.1.29554 WP_000068176.1.29557 WP_000068176.1.29561 WP_000068176.1.29571 WP_000068176.1.29596 WP_000068176.1.29644 WP_000068176.1.29676 WP_000068176.1.29692 WP_000068176.1.29709 WP_000068176.1.29710 WP_000068176.1.29716 WP_000068176.1.2972 WP_000068176.1.29731 WP_000068176.1.29736 WP_000068176.1.29744 WP_000068176.1.2975 WP_000068176.1.29758 WP_000068176.1.29781 WP_000068176.1.29788 WP_000068176.1.29805 WP_000068176.1.2981 WP_000068176.1.29826 WP_000068176.1.2983 WP_000068176.1.29862 WP_000068176.1.29885 WP_000068176.1.29902 WP_000068176.1.29905 WP_000068176.1.29918 WP_000068176.1.29956 WP_000068176.1.29963 WP_000068176.1.2997 WP_000068176.1.29981 WP_000068176.1.29982 WP_000068176.1.30012 WP_000068176.1.30023 WP_000068176.1.30033 WP_000068176.1.30047 WP_000068176.1.30051 WP_000068176.1.30057 WP_000068176.1.30095 WP_000068176.1.30100 WP_000068176.1.30115 WP_000068176.1.3012 WP_000068176.1.30130 WP_000068176.1.30150 WP_000068176.1.30152 WP_000068176.1.30154 WP_000068176.1.30159 WP_000068176.1.30169 WP_000068176.1.30176 WP_000068176.1.30186 WP_000068176.1.30188 WP_000068176.1.30190 WP_000068176.1.30191 WP_000068176.1.30197 WP_000068176.1.30203 WP_000068176.1.30204 WP_000068176.1.30209 WP_000068176.1.30230 WP_000068176.1.30249 WP_000068176.1.30262 WP_000068176.1.30268 WP_000068176.1.30274 WP_000068176.1.3029 WP_000068176.1.30294 WP_000068176.1.30302 WP_000068176.1.30307 WP_000068176.1.30328 WP_000068176.1.30333 WP_000068176.1.30350 WP_000068176.1.30364 WP_000068176.1.30367 WP_000068176.1.30376 WP_000068176.1.30381 WP_000068176.1.30385 WP_000068176.1.30392 WP_000068176.1.30418 WP_000068176.1.30422 WP_000068176.1.30458 WP_000068176.1.30477 WP_000068176.1.30482 WP_000068176.1.30496 WP_000068176.1.3050 WP_000068176.1.30508 WP_000068176.1.30530 WP_000068176.1.30531 WP_000068176.1.30560 WP_000068176.1.30566 WP_000068176.1.30568 WP_000068176.1.30600 WP_000068176.1.30622 WP_000068176.1.30623 WP_000068176.1.30645 WP_000068176.1.30646 WP_000068176.1.30648 WP_000068176.1.30650 WP_000068176.1.30652 WP_000068176.1.30666 WP_000068176.1.30668 WP_000068176.1.30690 WP_000068176.1.30702 WP_000068176.1.30720 WP_000068176.1.30726 WP_000068176.1.30758 WP_000068176.1.30763 WP_000068176.1.30768 WP_000068176.1.3077 WP_000068176.1.30779 WP_000068176.1.30845 WP_000068176.1.30846 WP_000068176.1.30847 WP_000068176.1.30854 WP_000068176.1.30861 WP_000068176.1.30862 WP_000068176.1.30863 WP_000068176.1.30874 WP_000068176.1.30878 WP_000068176.1.30880 WP_000068176.1.30889 WP_000068176.1.30907 WP_000068176.1.30911 WP_000068176.1.30915 WP_000068176.1.30916 WP_000068176.1.30928 WP_000068176.1.30945 WP_000068176.1.30962 WP_000068176.1.3097 WP_000068176.1.30970 WP_000068176.1.30971 WP_000068176.1.30998 WP_000068176.1.31005 WP_000068176.1.31022 WP_000068176.1.31037 WP_000068176.1.31039 WP_000068176.1.31041 WP_000068176.1.31048 WP_000068176.1.31065 WP_000068176.1.31068 WP_000068176.1.31077 WP_000068176.1.31091 WP_000068176.1.31113 WP_000068176.1.31114 WP_000068176.1.31120 WP_000068176.1.31123 WP_000068176.1.31124 WP_000068176.1.31176 WP_000068176.1.31194 WP_000068176.1.31202 WP_000068176.1.31204 WP_000068176.1.31206 WP_000068176.1.31212 WP_000068176.1.31232 WP_000068176.1.31278 WP_000068176.1.31294 WP_000068176.1.31315 WP_000068176.1.31337 WP_000068176.1.31339 WP_000068176.1.31355 WP_000068176.1.31363 WP_000068176.1.31376 WP_000068176.1.31377 WP_000068176.1.31402 WP_000068176.1.31424 WP_000068176.1.31426 WP_000068176.1.31436 WP_000068176.1.31437 WP_000068176.1.31441 WP_000068176.1.31442 WP_000068176.1.31462 WP_000068176.1.31478 WP_000068176.1.31479 WP_000068176.1.31484 WP_000068176.1.31497 WP_000068176.1.315 WP_000068176.1.31505 WP_000068176.1.31529 WP_000068176.1.31531 WP_000068176.1.31539 WP_000068176.1.31567 WP_000068176.1.31568 WP_000068176.1.31589 WP_000068176.1.31605 WP_000068176.1.31611 WP_000068176.1.31621 WP_000068176.1.31638 WP_000068176.1.31642 WP_000068176.1.31647 WP_000068176.1.31653 WP_000068176.1.31667 WP_000068176.1.31686 WP_000068176.1.31701 WP_000068176.1.31743 WP_000068176.1.31753 WP_000068176.1.31787 WP_000068176.1.31791 WP_000068176.1.31797 WP_000068176.1.31806 WP_000068176.1.31816 WP_000068176.1.31817 WP_000068176.1.31827 WP_000068176.1.31828 WP_000068176.1.31842 WP_000068176.1.3188 WP_000068176.1.31892 WP_000068176.1.31897 WP_000068176.1.31925 WP_000068176.1.31931 WP_000068176.1.31943 WP_000068176.1.31949 WP_000068176.1.31990 WP_000068176.1.31994 WP_000068176.1.31997 WP_000068176.1.32003 WP_000068176.1.32005 WP_000068176.1.32029 WP_000068176.1.32040 WP_000068176.1.32059 WP_000068176.1.32067 WP_000068176.1.32077 WP_000068176.1.32095 WP_000068176.1.32106 WP_000068176.1.32118 WP_000068176.1.32122 WP_000068176.1.32125 WP_000068176.1.32130 WP_000068176.1.32160 WP_000068176.1.32167 WP_000068176.1.3219 WP_000068176.1.32207 WP_000068176.1.32217 WP_000068176.1.32244 WP_000068176.1.32248 WP_000068176.1.32269 WP_000068176.1.32270 WP_000068176.1.32281 WP_000068176.1.3229 WP_000068176.1.32295 WP_000068176.1.32301 WP_000068176.1.3231 WP_000068176.1.32325 WP_000068176.1.32338 WP_000068176.1.32339 WP_000068176.1.32340 WP_000068176.1.32365 WP_000068176.1.32384 WP_000068176.1.32405 WP_000068176.1.3244 WP_000068176.1.32454 WP_000068176.1.32464 WP_000068176.1.32474 WP_000068176.1.32481 WP_000068176.1.32483 WP_000068176.1.32497 WP_000068176.1.32514 WP_000068176.1.32517 WP_000068176.1.32534 WP_000068176.1.32546 WP_000068176.1.32555 WP_000068176.1.32565 WP_000068176.1.32584 WP_000068176.1.32588 WP_000068176.1.32599 WP_000068176.1.32607 WP_000068176.1.32634 WP_000068176.1.32636 WP_000068176.1.32645 WP_000068176.1.32671 WP_000068176.1.32739 WP_000068176.1.32746 WP_000068176.1.32754 WP_000068176.1.32761 WP_000068176.1.32763 WP_000068176.1.32764 WP_000068176.1.32770 WP_000068176.1.32795 WP_000068176.1.328 WP_000068176.1.32800 WP_000068176.1.32829 WP_000068176.1.32839 WP_000068176.1.32898 WP_000068176.1.32921 WP_000068176.1.32925 WP_000068176.1.32928 WP_000068176.1.3293 WP_000068176.1.32939 WP_000068176.1.32954 WP_000068176.1.32965 WP_000068176.1.32980 WP_000068176.1.32987 WP_000068176.1.3299 WP_000068176.1.3301 WP_000068176.1.33029 WP_000068176.1.33038 WP_000068176.1.3306 WP_000068176.1.33067 WP_000068176.1.33108 WP_000068176.1.33110 WP_000068176.1.33123 WP_000068176.1.33138 WP_000068176.1.33147 WP_000068176.1.3316 WP_000068176.1.33161 WP_000068176.1.33172 WP_000068176.1.33199 WP_000068176.1.33212 WP_000068176.1.33213 WP_000068176.1.33250 WP_000068176.1.33252 WP_000068176.1.33255 WP_000068176.1.33266 WP_000068176.1.33277 WP_000068176.1.33292 WP_000068176.1.33296 WP_000068176.1.3330 WP_000068176.1.33307 WP_000068176.1.33322 WP_000068176.1.33328 WP_000068176.1.33335 WP_000068176.1.3335 WP_000068176.1.33350 WP_000068176.1.33357 WP_000068176.1.33368 WP_000068176.1.33372 WP_000068176.1.3338 WP_000068176.1.33388 WP_000068176.1.33394 WP_000068176.1.3342 WP_000068176.1.33426 WP_000068176.1.3343 WP_000068176.1.33432 WP_000068176.1.3345 WP_000068176.1.33463 WP_000068176.1.33468 WP_000068176.1.3347 WP_000068176.1.33483 WP_000068176.1.33484 WP_000068176.1.33507 WP_000068176.1.33516 WP_000068176.1.33518 WP_000068176.1.33520 WP_000068176.1.33538 WP_000068176.1.33540 WP_000068176.1.33567 WP_000068176.1.3357 WP_000068176.1.33575 WP_000068176.1.3358 WP_000068176.1.33594 WP_000068176.1.33607 WP_000068176.1.33610 WP_000068176.1.33626 WP_000068176.1.33627 WP_000068176.1.3363 WP_000068176.1.33640 WP_000068176.1.33650 WP_000068176.1.33654 WP_000068176.1.33655 WP_000068176.1.33692 WP_000068176.1.33695 WP_000068176.1.33707 WP_000068176.1.33718 WP_000068176.1.33720 WP_000068176.1.33724 WP_000068176.1.33735 WP_000068176.1.33737 WP_000068176.1.33743 WP_000068176.1.33756 WP_000068176.1.33765 WP_000068176.1.33766 WP_000068176.1.33767 WP_000068176.1.33769 WP_000068176.1.33778 WP_000068176.1.33792 WP_000068176.1.33804 WP_000068176.1.33813 WP_000068176.1.33816 WP_000068176.1.33850 WP_000068176.1.33855 WP_000068176.1.33899 WP_000068176.1.33915 WP_000068176.1.33940 WP_000068176.1.33963 WP_000068176.1.33966 WP_000068176.1.33968 WP_000068176.1.33971 WP_000068176.1.33989 WP_000068176.1.33994 WP_000068176.1.34026 WP_000068176.1.34030 WP_000068176.1.34051 WP_000068176.1.34060 WP_000068176.1.34062 WP_000068176.1.34069 WP_000068176.1.34078 WP_000068176.1.34079 WP_000068176.1.34080 WP_000068176.1.34089 WP_000068176.1.34100 WP_000068176.1.34105 WP_000068176.1.34112 WP_000068176.1.34128 WP_000068176.1.34132 WP_000068176.1.34168 WP_000068176.1.34172 WP_000068176.1.3418 WP_000068176.1.34182 WP_000068176.1.34194 WP_000068176.1.34209 WP_000068176.1.3422 WP_000068176.1.34223 WP_000068176.1.34231 WP_000068176.1.34244 WP_000068176.1.34250 WP_000068176.1.34251 WP_000068176.1.34254 WP_000068176.1.34280 WP_000068176.1.34285 WP_000068176.1.34307 WP_000068176.1.34334 WP_000068176.1.34361 WP_000068176.1.34371 WP_000068176.1.34381 WP_000068176.1.34403 WP_000068176.1.34410 WP_000068176.1.3442 WP_000068176.1.34427 WP_000068176.1.34436 WP_000068176.1.34438 WP_000068176.1.34471 WP_000068176.1.34473 WP_000068176.1.3448 WP_000068176.1.34482 WP_000068176.1.34492 WP_000068176.1.34502 WP_000068176.1.34510 WP_000068176.1.34512 WP_000068176.1.34526 WP_000068176.1.34531 WP_000068176.1.34569 WP_000068176.1.34578 WP_000068176.1.3461 WP_000068176.1.34620 WP_000068176.1.34626 WP_000068176.1.34666 WP_000068176.1.34677 WP_000068176.1.34716 WP_000068176.1.34723 WP_000068176.1.34733 WP_000068176.1.34737 WP_000068176.1.3474 WP_000068176.1.34741 WP_000068176.1.34767 WP_000068176.1.34774 WP_000068176.1.34818 WP_000068176.1.34847 WP_000068176.1.34865 WP_000068176.1.34877 WP_000068176.1.34890 WP_000068176.1.34912 WP_000068176.1.34918 WP_000068176.1.34926 WP_000068176.1.34943 WP_000068176.1.34967 WP_000068176.1.34970 WP_000068176.1.34998 WP_000068176.1.35014 WP_000068176.1.35029 WP_000068176.1.35031 WP_000068176.1.35032 WP_000068176.1.35054 WP_000068176.1.35059 WP_000068176.1.35062 WP_000068176.1.35089 WP_000068176.1.35097 WP_000068176.1.35106 WP_000068176.1.35108 WP_000068176.1.35110 WP_000068176.1.35121 WP_000068176.1.35177 WP_000068176.1.35182 WP_000068176.1.35183 WP_000068176.1.35189 WP_000068176.1.35194 WP_000068176.1.35222 WP_000068176.1.35233 WP_000068176.1.35243 WP_000068176.1.35257 WP_000068176.1.3526 WP_000068176.1.35264 WP_000068176.1.35276 WP_000068176.1.35289 WP_000068176.1.35297 WP_000068176.1.35307 WP_000068176.1.35314 WP_000068176.1.35334 WP_000068176.1.35340 WP_000068176.1.35342 WP_000068176.1.35345 WP_000068176.1.35352 WP_000068176.1.35391 WP_000068176.1.354 WP_000068176.1.35413 WP_000068176.1.35415 WP_000068176.1.3542 WP_000068176.1.35423 WP_000068176.1.35433 WP_000068176.1.35435 WP_000068176.1.3547 WP_000068176.1.3549 WP_000068176.1.35490 WP_000068176.1.35497 WP_000068176.1.35498 WP_000068176.1.35506 WP_000068176.1.35508 WP_000068176.1.35517 WP_000068176.1.35519 WP_000068176.1.3552 WP_000068176.1.35525 WP_000068176.1.35549 WP_000068176.1.35580 WP_000068176.1.35615 WP_000068176.1.35623 WP_000068176.1.35642 WP_000068176.1.35643 WP_000068176.1.35659 WP_000068176.1.35661 WP_000068176.1.35673 WP_000068176.1.35686 WP_000068176.1.3569 WP_000068176.1.35696 WP_000068176.1.35730 WP_000068176.1.3574 WP_000068176.1.35742 WP_000068176.1.35746 WP_000068176.1.35774 WP_000068176.1.35784 WP_000068176.1.3579 WP_000068176.1.35794 WP_000068176.1.35799 WP_000068176.1.35826 WP_000068176.1.35837 WP_000068176.1.35890 WP_000068176.1.35900 WP_000068176.1.35903 WP_000068176.1.35928 WP_000068176.1.35950 WP_000068176.1.35958 WP_000068176.1.36004 WP_000068176.1.36021 WP_000068176.1.36041 WP_000068176.1.36082 WP_000068176.1.36093 WP_000068176.1.36102 WP_000068176.1.3611 WP_000068176.1.36117 WP_000068176.1.36119 WP_000068176.1.36141 WP_000068176.1.3617 WP_000068176.1.36175 WP_000068176.1.36179 WP_000068176.1.36187 WP_000068176.1.36188 WP_000068176.1.36193 WP_000068176.1.36208 WP_000068176.1.36211 WP_000068176.1.36220 WP_000068176.1.36223 WP_000068176.1.3623 WP_000068176.1.36231 WP_000068176.1.36249 WP_000068176.1.36250 WP_000068176.1.36264 WP_000068176.1.36278 WP_000068176.1.36282 WP_000068176.1.36283 WP_000068176.1.36302 WP_000068176.1.36307 WP_000068176.1.36325 WP_000068176.1.36344 WP_000068176.1.36389 WP_000068176.1.36430 WP_000068176.1.36434 WP_000068176.1.36439 WP_000068176.1.36522 WP_000068176.1.36532 WP_000068176.1.36535 WP_000068176.1.3655 WP_000068176.1.36551 WP_000068176.1.36570 WP_000068176.1.36580 WP_000068176.1.36600 WP_000068176.1.36604 WP_000068176.1.36615 WP_000068176.1.36640 WP_000068176.1.36646 WP_000068176.1.3666 WP_000068176.1.36669 WP_000068176.1.36689 WP_000068176.1.36697 WP_000068176.1.36698 WP_000068176.1.36704 WP_000068176.1.36729 WP_000068176.1.36745 WP_000068176.1.3675 WP_000068176.1.36754 WP_000068176.1.36770 WP_000068176.1.36773 WP_000068176.1.36783 WP_000068176.1.36793 WP_000068176.1.36796 WP_000068176.1.36797 WP_000068176.1.36809 WP_000068176.1.36814 WP_000068176.1.36820 WP_000068176.1.36822 WP_000068176.1.36823 WP_000068176.1.36847 WP_000068176.1.3685 WP_000068176.1.36858 WP_000068176.1.3687 WP_000068176.1.36884 WP_000068176.1.36888 WP_000068176.1.3690 WP_000068176.1.36911 WP_000068176.1.36916 WP_000068176.1.36932 WP_000068176.1.36952 WP_000068176.1.36955 WP_000068176.1.36962 WP_000068176.1.36979 WP_000068176.1.36983 WP_000068176.1.36997 WP_000068176.1.37002 WP_000068176.1.37016 WP_000068176.1.3703 WP_000068176.1.37044 WP_000068176.1.37045 WP_000068176.1.37053 WP_000068176.1.37055 WP_000068176.1.37075 WP_000068176.1.37080 WP_000068176.1.3709 WP_000068176.1.37091 WP_000068176.1.37120 WP_000068176.1.37121 WP_000068176.1.37130 WP_000068176.1.37132 WP_000068176.1.37134 WP_000068176.1.37135 WP_000068176.1.37145 WP_000068176.1.37159 WP_000068176.1.3718 WP_000068176.1.3719 WP_000068176.1.3722 WP_000068176.1.37220 WP_000068176.1.37240 WP_000068176.1.37304 WP_000068176.1.37335 WP_000068176.1.37336 WP_000068176.1.37341 WP_000068176.1.37354 WP_000068176.1.37378 WP_000068176.1.37398 WP_000068176.1.37408 WP_000068176.1.37411 WP_000068176.1.37424 WP_000068176.1.37435 WP_000068176.1.37453 WP_000068176.1.37467 WP_000068176.1.37503 WP_000068176.1.37525 WP_000068176.1.37536 WP_000068176.1.37546 WP_000068176.1.37563 WP_000068176.1.37578 WP_000068176.1.37583 WP_000068176.1.37602 WP_000068176.1.37605 WP_000068176.1.37621 WP_000068176.1.37624 WP_000068176.1.37636 WP_000068176.1.37644 WP_000068176.1.37652 WP_000068176.1.37669 WP_000068176.1.37679 WP_000068176.1.3774 WP_000068176.1.37749 WP_000068176.1.3776 WP_000068176.1.37764 WP_000068176.1.37771 WP_000068176.1.37781 WP_000068176.1.37788 WP_000068176.1.37795 WP_000068176.1.37815 WP_000068176.1.37828 WP_000068176.1.37851 WP_000068176.1.37855 WP_000068176.1.37866 WP_000068176.1.37875 WP_000068176.1.37878 WP_000068176.1.37891 WP_000068176.1.37906 WP_000068176.1.37907 WP_000068176.1.37929 WP_000068176.1.37953 WP_000068176.1.37987 WP_000068176.1.38007 WP_000068176.1.38020 WP_000068176.1.38030 WP_000068176.1.38034 WP_000068176.1.38038 WP_000068176.1.38057 WP_000068176.1.38070 WP_000068176.1.38082 WP_000068176.1.3809 WP_000068176.1.38100 WP_000068176.1.38111 WP_000068176.1.38128 WP_000068176.1.3813 WP_000068176.1.38136 WP_000068176.1.38160 WP_000068176.1.3817 WP_000068176.1.38177 WP_000068176.1.3820 WP_000068176.1.38212 WP_000068176.1.38222 WP_000068176.1.38229 WP_000068176.1.38230 WP_000068176.1.38232 WP_000068176.1.3827 WP_000068176.1.38276 WP_000068176.1.38304 WP_000068176.1.38309 WP_000068176.1.38311 WP_000068176.1.38316 WP_000068176.1.38330 WP_000068176.1.38336 WP_000068176.1.38339 WP_000068176.1.38346 WP_000068176.1.38383 WP_000068176.1.38390 WP_000068176.1.3842 WP_000068176.1.38422 WP_000068176.1.38435 WP_000068176.1.38437 WP_000068176.1.38453 WP_000068176.1.38489 WP_000068176.1.38491 WP_000068176.1.38493 WP_000068176.1.38516 WP_000068176.1.38546 WP_000068176.1.38551 WP_000068176.1.38555 WP_000068176.1.38557 WP_000068176.1.38600 WP_000068176.1.38607 WP_000068176.1.38612 WP_000068176.1.38637 WP_000068176.1.38651 WP_000068176.1.38658 WP_000068176.1.38669 WP_000068176.1.3867 WP_000068176.1.38688 WP_000068176.1.38721 WP_000068176.1.3875 WP_000068176.1.38760 WP_000068176.1.38786 WP_000068176.1.38788 WP_000068176.1.38823 WP_000068176.1.38836 WP_000068176.1.38841 WP_000068176.1.38858 WP_000068176.1.38862 WP_000068176.1.38875 WP_000068176.1.38885 WP_000068176.1.38890 WP_000068176.1.38926 WP_000068176.1.38927 WP_000068176.1.38931 WP_000068176.1.3894 WP_000068176.1.38940 WP_000068176.1.38941 WP_000068176.1.38943 WP_000068176.1.38960 WP_000068176.1.38972 WP_000068176.1.38973 WP_000068176.1.38979 WP_000068176.1.38985 WP_000068176.1.38989 WP_000068176.1.390 WP_000068176.1.39012 WP_000068176.1.39014 WP_000068176.1.39017 WP_000068176.1.39026 WP_000068176.1.39043 WP_000068176.1.39053 WP_000068176.1.3906 WP_000068176.1.3908 WP_000068176.1.39080 WP_000068176.1.39089 WP_000068176.1.39108 WP_000068176.1.39117 WP_000068176.1.39126 WP_000068176.1.39166 WP_000068176.1.39203 WP_000068176.1.39206 WP_000068176.1.39217 WP_000068176.1.39241 WP_000068176.1.3926 WP_000068176.1.39272 WP_000068176.1.39281 WP_000068176.1.39285 WP_000068176.1.39290 WP_000068176.1.39324 WP_000068176.1.39330 WP_000068176.1.39332 WP_000068176.1.39333 WP_000068176.1.39347 WP_000068176.1.39361 WP_000068176.1.39378 WP_000068176.1.39384 WP_000068176.1.39397 WP_000068176.1.39432 WP_000068176.1.39451 WP_000068176.1.39486 WP_000068176.1.39494 WP_000068176.1.39499 WP_000068176.1.39506 WP_000068176.1.39519 WP_000068176.1.39527 WP_000068176.1.39542 WP_000068176.1.39550 WP_000068176.1.39613 WP_000068176.1.39625 WP_000068176.1.39642 WP_000068176.1.39645 WP_000068176.1.39662 WP_000068176.1.39670 WP_000068176.1.39671 WP_000068176.1.39682 WP_000068176.1.39687 WP_000068176.1.39689 WP_000068176.1.39693 WP_000068176.1.39697 WP_000068176.1.39711 WP_000068176.1.39738 WP_000068176.1.39767 WP_000068176.1.39773 WP_000068176.1.39789 WP_000068176.1.39832 WP_000068176.1.39834 WP_000068176.1.39838 WP_000068176.1.39839 WP_000068176.1.39847 WP_000068176.1.39856 WP_000068176.1.39857 WP_000068176.1.39869 WP_000068176.1.39875 WP_000068176.1.39880 WP_000068176.1.39883 WP_000068176.1.39918 WP_000068176.1.39943 WP_000068176.1.39995 WP_000068176.1.40014 WP_000068176.1.40043 WP_000068176.1.40053 WP_000068176.1.4006 WP_000068176.1.40076 WP_000068176.1.40082 WP_000068176.1.40085 WP_000068176.1.40099 WP_000068176.1.4010 WP_000068176.1.40119 WP_000068176.1.4012 WP_000068176.1.40120 WP_000068176.1.40130 WP_000068176.1.40137 WP_000068176.1.40149 WP_000068176.1.4015 WP_000068176.1.40161 WP_000068176.1.40164 WP_000068176.1.40173 WP_000068176.1.4019 WP_000068176.1.40220 WP_000068176.1.40247 WP_000068176.1.4025 WP_000068176.1.40299 WP_000068176.1.40316 WP_000068176.1.40318 WP_000068176.1.40320 WP_000068176.1.40322 WP_000068176.1.40329 WP_000068176.1.40330 WP_000068176.1.40340 WP_000068176.1.40342 WP_000068176.1.40368 WP_000068176.1.40369 WP_000068176.1.40383 WP_000068176.1.40401 WP_000068176.1.40409 WP_000068176.1.40428 WP_000068176.1.40435 WP_000068176.1.40443 WP_000068176.1.4045 WP_000068176.1.40454 WP_000068176.1.40458 WP_000068176.1.40463 WP_000068176.1.40472 WP_000068176.1.40474 WP_000068176.1.40481 WP_000068176.1.40483 WP_000068176.1.40500 WP_000068176.1.40505 WP_000068176.1.40531 WP_000068176.1.40532 WP_000068176.1.40554 WP_000068176.1.4056 WP_000068176.1.4057 WP_000068176.1.40579 WP_000068176.1.40588 WP_000068176.1.40613 WP_000068176.1.40644 WP_000068176.1.40655 WP_000068176.1.40658 WP_000068176.1.40659 WP_000068176.1.40670 WP_000068176.1.40700 WP_000068176.1.40719 WP_000068176.1.40729 WP_000068176.1.40748 WP_000068176.1.40760 WP_000068176.1.4078 WP_000068176.1.40780 WP_000068176.1.40794 WP_000068176.1.40797 WP_000068176.1.40800 WP_000068176.1.40814 WP_000068176.1.40816 WP_000068176.1.40939 WP_000068176.1.40954 WP_000068176.1.40997 WP_000068176.1.41002 WP_000068176.1.41011 WP_000068176.1.4102 WP_000068176.1.41033 WP_000068176.1.41038 WP_000068176.1.4105 WP_000068176.1.41058 WP_000068176.1.41066 WP_000068176.1.41084 WP_000068176.1.41094 WP_000068176.1.41104 WP_000068176.1.41109 WP_000068176.1.41119 WP_000068176.1.41122 WP_000068176.1.41129 WP_000068176.1.41133 WP_000068176.1.4115 WP_000068176.1.41178 WP_000068176.1.412 WP_000068176.1.41208 WP_000068176.1.41238 WP_000068176.1.41241 WP_000068176.1.41245 WP_000068176.1.41255 WP_000068176.1.41288 WP_000068176.1.41289 WP_000068176.1.4129 WP_000068176.1.41314 WP_000068176.1.41341 WP_000068176.1.41350 WP_000068176.1.41374 WP_000068176.1.4138 WP_000068176.1.41386 WP_000068176.1.41411 WP_000068176.1.41426 WP_000068176.1.41432 WP_000068176.1.41433 WP_000068176.1.4144 WP_000068176.1.41444 WP_000068176.1.41448 WP_000068176.1.41456 WP_000068176.1.41458 WP_000068176.1.41461 WP_000068176.1.41473 WP_000068176.1.41499 WP_000068176.1.41511 WP_000068176.1.41532 WP_000068176.1.41533 WP_000068176.1.41537 WP_000068176.1.41555 WP_000068176.1.41558 WP_000068176.1.41567 WP_000068176.1.41581 WP_000068176.1.41582 WP_000068176.1.41587 WP_000068176.1.41597 WP_000068176.1.41598 WP_000068176.1.41599 WP_000068176.1.4160 WP_000068176.1.41612 WP_000068176.1.4162 WP_000068176.1.41620 WP_000068176.1.41623 WP_000068176.1.41647 WP_000068176.1.41674 WP_000068176.1.41681 WP_000068176.1.4169 WP_000068176.1.41698 WP_000068176.1.41726 WP_000068176.1.41743 WP_000068176.1.41755 WP_000068176.1.41770 WP_000068176.1.41796 WP_000068176.1.41817 WP_000068176.1.4182 WP_000068176.1.41821 WP_000068176.1.41839 WP_000068176.1.41863 WP_000068176.1.4188 WP_000068176.1.41891 WP_000068176.1.41898 WP_000068176.1.41906 WP_000068176.1.41935 WP_000068176.1.41943 WP_000068176.1.41954 WP_000068176.1.41972 WP_000068176.1.41983 WP_000068176.1.41989 WP_000068176.1.420 WP_000068176.1.42001 WP_000068176.1.42003 WP_000068176.1.42005 WP_000068176.1.42015 WP_000068176.1.42017 WP_000068176.1.4202 WP_000068176.1.42028 WP_000068176.1.42064 WP_000068176.1.42072 WP_000068176.1.42085 WP_000068176.1.42087 WP_000068176.1.42125 WP_000068176.1.42137 WP_000068176.1.42169 WP_000068176.1.42177 WP_000068176.1.42178 WP_000068176.1.42230 WP_000068176.1.42241 WP_000068176.1.4225 WP_000068176.1.42269 WP_000068176.1.42286 WP_000068176.1.42298 WP_000068176.1.42305 WP_000068176.1.4231 WP_000068176.1.42325 WP_000068176.1.42336 WP_000068176.1.42344 WP_000068176.1.42355 WP_000068176.1.42403 WP_000068176.1.42436 WP_000068176.1.42438 WP_000068176.1.42455 WP_000068176.1.42459 WP_000068176.1.42460 WP_000068176.1.42481 WP_000068176.1.42503 WP_000068176.1.42510 WP_000068176.1.42517 WP_000068176.1.42551 WP_000068176.1.42575 WP_000068176.1.42593 WP_000068176.1.42598 WP_000068176.1.426 WP_000068176.1.4260 WP_000068176.1.42607 WP_000068176.1.42640 WP_000068176.1.42652 WP_000068176.1.42667 WP_000068176.1.42668 WP_000068176.1.42674 WP_000068176.1.42679 WP_000068176.1.42681 WP_000068176.1.42706 WP_000068176.1.42733 WP_000068176.1.42737 WP_000068176.1.42738 WP_000068176.1.42740 WP_000068176.1.42759 WP_000068176.1.42764 WP_000068176.1.42786 WP_000068176.1.42788 WP_000068176.1.42798 WP_000068176.1.42802 WP_000068176.1.42816 WP_000068176.1.42819 WP_000068176.1.42837 WP_000068176.1.42848 WP_000068176.1.42883 WP_000068176.1.42893 WP_000068176.1.42897 WP_000068176.1.42907 WP_000068176.1.42924 WP_000068176.1.42925 WP_000068176.1.4293 WP_000068176.1.42959 WP_000068176.1.42982 WP_000068176.1.42984 WP_000068176.1.42985 WP_000068176.1.42990 WP_000068176.1.4300 WP_000068176.1.43014 WP_000068176.1.43020 WP_000068176.1.43023 WP_000068176.1.43033 WP_000068176.1.43047 WP_000068176.1.43061 WP_000068176.1.43072 WP_000068176.1.43095 WP_000068176.1.43110 WP_000068176.1.43114 WP_000068176.1.43125 WP_000068176.1.43131 WP_000068176.1.43134 WP_000068176.1.43139 WP_000068176.1.43143 WP_000068176.1.43147 WP_000068176.1.43159 WP_000068176.1.43165 WP_000068176.1.43168 WP_000068176.1.43179 WP_000068176.1.43200 WP_000068176.1.43202 WP_000068176.1.43204 WP_000068176.1.43206 WP_000068176.1.43220 WP_000068176.1.43232 WP_000068176.1.43248 WP_000068176.1.4325 WP_000068176.1.43252 WP_000068176.1.43263 WP_000068176.1.4327 WP_000068176.1.43274 WP_000068176.1.43279 WP_000068176.1.43323 WP_000068176.1.43325 WP_000068176.1.43328 WP_000068176.1.43331 WP_000068176.1.43341 WP_000068176.1.43349 WP_000068176.1.43360 WP_000068176.1.43366 WP_000068176.1.43369 WP_000068176.1.4337 WP_000068176.1.43375 WP_000068176.1.43383 WP_000068176.1.43405 WP_000068176.1.43406 WP_000068176.1.4341 WP_000068176.1.43410 WP_000068176.1.43414 WP_000068176.1.43446 WP_000068176.1.43460 WP_000068176.1.4347 WP_000068176.1.43506 WP_000068176.1.43512 WP_000068176.1.43530 WP_000068176.1.43560 WP_000068176.1.43573 WP_000068176.1.43594 WP_000068176.1.43600 WP_000068176.1.43617 WP_000068176.1.43627 WP_000068176.1.43659 WP_000068176.1.43665 WP_000068176.1.43670 WP_000068176.1.43683 WP_000068176.1.4369 WP_000068176.1.43693 WP_000068176.1.4370 WP_000068176.1.43702 WP_000068176.1.43703 WP_000068176.1.4372 WP_000068176.1.43731 WP_000068176.1.4374 WP_000068176.1.43752 WP_000068176.1.43784 WP_000068176.1.43788 WP_000068176.1.4379 WP_000068176.1.43800 WP_000068176.1.43819 WP_000068176.1.43822 WP_000068176.1.43827 WP_000068176.1.4385 WP_000068176.1.43851 WP_000068176.1.4386 WP_000068176.1.43904 WP_000068176.1.43915 WP_000068176.1.43924 WP_000068176.1.43964 WP_000068176.1.43984 WP_000068176.1.43988 WP_000068176.1.43995 WP_000068176.1.44021 WP_000068176.1.44072 WP_000068176.1.44074 WP_000068176.1.44095 WP_000068176.1.44119 WP_000068176.1.44150 WP_000068176.1.44153 WP_000068176.1.44177 WP_000068176.1.44178 WP_000068176.1.44181 WP_000068176.1.44186 WP_000068176.1.44195 WP_000068176.1.44255 WP_000068176.1.44265 WP_000068176.1.44302 WP_000068176.1.44312 WP_000068176.1.44331 WP_000068176.1.44344 WP_000068176.1.44382 WP_000068176.1.44388 WP_000068176.1.44396 WP_000068176.1.44405 WP_000068176.1.44420 WP_000068176.1.44432 WP_000068176.1.44455 WP_000068176.1.44480 WP_000068176.1.44493 WP_000068176.1.44504 WP_000068176.1.44515 WP_000068176.1.44517 WP_000068176.1.44520 WP_000068176.1.44536 WP_000068176.1.44544 WP_000068176.1.44547 WP_000068176.1.44579 WP_000068176.1.44586 WP_000068176.1.44588 WP_000068176.1.44605 WP_000068176.1.44623 WP_000068176.1.44631 WP_000068176.1.44646 WP_000068176.1.44655 WP_000068176.1.44667 WP_000068176.1.44672 WP_000068176.1.44674 WP_000068176.1.447 WP_000068176.1.44714 WP_000068176.1.44715 WP_000068176.1.44732 WP_000068176.1.44755 WP_000068176.1.44768 WP_000068176.1.44780 WP_000068176.1.44785 WP_000068176.1.44788 WP_000068176.1.44796 WP_000068176.1.44802 WP_000068176.1.44853 WP_000068176.1.44856 WP_000068176.1.44868 WP_000068176.1.44876 WP_000068176.1.44881 WP_000068176.1.44882 WP_000068176.1.44891 WP_000068176.1.44892 WP_000068176.1.44899 WP_000068176.1.44903 WP_000068176.1.44914 WP_000068176.1.44932 WP_000068176.1.44940 WP_000068176.1.44948 WP_000068176.1.44955 WP_000068176.1.44969 WP_000068176.1.4499 WP_000068176.1.44993 WP_000068176.1.45008 WP_000068176.1.45010 WP_000068176.1.45015 WP_000068176.1.45033 WP_000068176.1.45035 WP_000068176.1.45042 WP_000068176.1.45050 WP_000068176.1.45080 WP_000068176.1.45091 WP_000068176.1.45094 WP_000068176.1.45099 WP_000068176.1.45101 WP_000068176.1.45111 WP_000068176.1.45114 WP_000068176.1.4513 WP_000068176.1.45131 WP_000068176.1.45132 WP_000068176.1.45133 WP_000068176.1.45140 WP_000068176.1.45162 WP_000068176.1.45164 WP_000068176.1.45170 WP_000068176.1.45188 WP_000068176.1.45189 WP_000068176.1.452 WP_000068176.1.45218 WP_000068176.1.45221 WP_000068176.1.45223 WP_000068176.1.45242 WP_000068176.1.45267 WP_000068176.1.4527 WP_000068176.1.45272 WP_000068176.1.45281 WP_000068176.1.45290 WP_000068176.1.45297 WP_000068176.1.453 WP_000068176.1.45303 WP_000068176.1.45321 WP_000068176.1.45364 WP_000068176.1.45419 WP_000068176.1.45439 WP_000068176.1.45447 WP_000068176.1.4545 WP_000068176.1.45450 WP_000068176.1.45456 WP_000068176.1.4546 WP_000068176.1.45472 WP_000068176.1.45492 WP_000068176.1.4550 WP_000068176.1.45507 WP_000068176.1.45542 WP_000068176.1.45555 WP_000068176.1.45560 WP_000068176.1.45574 WP_000068176.1.45577 WP_000068176.1.45610 WP_000068176.1.45620 WP_000068176.1.45640 WP_000068176.1.45645 WP_000068176.1.45654 WP_000068176.1.45670 WP_000068176.1.45698 WP_000068176.1.45703 WP_000068176.1.45705 WP_000068176.1.45713 WP_000068176.1.45730 WP_000068176.1.45734 WP_000068176.1.45747 WP_000068176.1.45763 WP_000068176.1.45768 WP_000068176.1.4577 WP_000068176.1.45771 WP_000068176.1.45773 WP_000068176.1.45780 WP_000068176.1.4580 WP_000068176.1.4582 WP_000068176.1.45822 WP_000068176.1.4584 WP_000068176.1.45852 WP_000068176.1.45859 WP_000068176.1.45862 WP_000068176.1.45870 WP_000068176.1.45874 WP_000068176.1.45875 WP_000068176.1.45878 WP_000068176.1.45881 WP_000068176.1.45888 WP_000068176.1.45897 WP_000068176.1.459 WP_000068176.1.45954 WP_000068176.1.4597 WP_000068176.1.45972 WP_000068176.1.45977 WP_000068176.1.45979 WP_000068176.1.4598 WP_000068176.1.46003 WP_000068176.1.46005 WP_000068176.1.46013 WP_000068176.1.46021 WP_000068176.1.46035 WP_000068176.1.46037 WP_000068176.1.46050 WP_000068176.1.46055 WP_000068176.1.46062 WP_000068176.1.46071 WP_000068176.1.46078 WP_000068176.1.46082 WP_000068176.1.46087 WP_000068176.1.46106 WP_000068176.1.46109 WP_000068176.1.46136 WP_000068176.1.46171 WP_000068176.1.46172 WP_000068176.1.46185 WP_000068176.1.46195 WP_000068176.1.46208 WP_000068176.1.46212 WP_000068176.1.46222 WP_000068176.1.46228 WP_000068176.1.46248 WP_000068176.1.46259 WP_000068176.1.46276 WP_000068176.1.46289 WP_000068176.1.46320 WP_000068176.1.46330 WP_000068176.1.46333 WP_000068176.1.46334 WP_000068176.1.46339 WP_000068176.1.46353 WP_000068176.1.46362 WP_000068176.1.46368 WP_000068176.1.46380 WP_000068176.1.46389 WP_000068176.1.46401 WP_000068176.1.46418 WP_000068176.1.46422 WP_000068176.1.46457 WP_000068176.1.46465 WP_000068176.1.46488 WP_000068176.1.46514 WP_000068176.1.46528 WP_000068176.1.46529 WP_000068176.1.46534 WP_000068176.1.46543 WP_000068176.1.46576 WP_000068176.1.46587 WP_000068176.1.46608 WP_000068176.1.46619 WP_000068176.1.4662 WP_000068176.1.46648 WP_000068176.1.46660 WP_000068176.1.46664 WP_000068176.1.46676 WP_000068176.1.46688 WP_000068176.1.46692 WP_000068176.1.46696 WP_000068176.1.46702 WP_000068176.1.46703 WP_000068176.1.46720 WP_000068176.1.46736 WP_000068176.1.46752 WP_000068176.1.46765 WP_000068176.1.46767 WP_000068176.1.46770 WP_000068176.1.46772 WP_000068176.1.4680 WP_000068176.1.46815 WP_000068176.1.46823 WP_000068176.1.46837 WP_000068176.1.46852 WP_000068176.1.46875 WP_000068176.1.46906 WP_000068176.1.46908 WP_000068176.1.46911 WP_000068176.1.46914 WP_000068176.1.46925 WP_000068176.1.46929 WP_000068176.1.46937 WP_000068176.1.4694 WP_000068176.1.46947 WP_000068176.1.46964 WP_000068176.1.46965 WP_000068176.1.46983 WP_000068176.1.47002 WP_000068176.1.47051 WP_000068176.1.47065 WP_000068176.1.47090 WP_000068176.1.47105 WP_000068176.1.47107 WP_000068176.1.47111 WP_000068176.1.47128 WP_000068176.1.47153 WP_000068176.1.47159 WP_000068176.1.4716 WP_000068176.1.47163 WP_000068176.1.47175 WP_000068176.1.47187 WP_000068176.1.47205 WP_000068176.1.47211 WP_000068176.1.47216 WP_000068176.1.47218 WP_000068176.1.47258 WP_000068176.1.47269 WP_000068176.1.47276 WP_000068176.1.47279 WP_000068176.1.4728 WP_000068176.1.47282 WP_000068176.1.47290 WP_000068176.1.47306 WP_000068176.1.47308 WP_000068176.1.47317 WP_000068176.1.47328 WP_000068176.1.47331 WP_000068176.1.47334 WP_000068176.1.47353 WP_000068176.1.47381 WP_000068176.1.47383 WP_000068176.1.47399 WP_000068176.1.47405 WP_000068176.1.47406 WP_000068176.1.47408 WP_000068176.1.47422 WP_000068176.1.47426 WP_000068176.1.47432 WP_000068176.1.47450 WP_000068176.1.47459 WP_000068176.1.47493 WP_000068176.1.4752 WP_000068176.1.47522 WP_000068176.1.47530 WP_000068176.1.47541 WP_000068176.1.47554 WP_000068176.1.47560 WP_000068176.1.47561 WP_000068176.1.47570 WP_000068176.1.47577 WP_000068176.1.47617 WP_000068176.1.47618 WP_000068176.1.47629 WP_000068176.1.47667 WP_000068176.1.47669 WP_000068176.1.4767 WP_000068176.1.47680 WP_000068176.1.477 WP_000068176.1.47702 WP_000068176.1.47719 WP_000068176.1.47733 WP_000068176.1.47747 WP_000068176.1.47763 WP_000068176.1.47782 WP_000068176.1.47792 WP_000068176.1.47821 WP_000068176.1.47835 WP_000068176.1.47836 WP_000068176.1.47851 WP_000068176.1.47859 WP_000068176.1.47864 WP_000068176.1.47872 WP_000068176.1.47873 WP_000068176.1.47888 WP_000068176.1.47901 WP_000068176.1.47904 WP_000068176.1.47908 WP_000068176.1.4792 WP_000068176.1.47951 WP_000068176.1.47980 WP_000068176.1.47989 WP_000068176.1.47996 WP_000068176.1.48009 WP_000068176.1.48011 WP_000068176.1.48013 WP_000068176.1.48017 WP_000068176.1.48030 WP_000068176.1.48046 WP_000068176.1.48047 WP_000068176.1.4805 WP_000068176.1.48057 WP_000068176.1.48064 WP_000068176.1.48067 WP_000068176.1.48116 WP_000068176.1.48142 WP_000068176.1.48149 WP_000068176.1.48154 WP_000068176.1.48156 WP_000068176.1.48169 WP_000068176.1.48186 WP_000068176.1.48187 WP_000068176.1.48197 WP_000068176.1.48199 WP_000068176.1.48205 WP_000068176.1.48212 WP_000068176.1.48223 WP_000068176.1.48227 WP_000068176.1.48236 WP_000068176.1.48250 WP_000068176.1.48272 WP_000068176.1.48282 WP_000068176.1.48284 WP_000068176.1.48293 WP_000068176.1.48307 WP_000068176.1.48310 WP_000068176.1.48322 WP_000068176.1.48326 WP_000068176.1.48335 WP_000068176.1.48338 WP_000068176.1.48364 WP_000068176.1.48376 WP_000068176.1.48391 WP_000068176.1.48394 WP_000068176.1.48398 WP_000068176.1.484 WP_000068176.1.4840 WP_000068176.1.48425 WP_000068176.1.48427 WP_000068176.1.48437 WP_000068176.1.48438 WP_000068176.1.48463 WP_000068176.1.48479 WP_000068176.1.48492 WP_000068176.1.4852 WP_000068176.1.48556 WP_000068176.1.48563 WP_000068176.1.48577 WP_000068176.1.48580 WP_000068176.1.48593 WP_000068176.1.48601 WP_000068176.1.48634 WP_000068176.1.48655 WP_000068176.1.48656 WP_000068176.1.48664 WP_000068176.1.48670 WP_000068176.1.4868 WP_000068176.1.48694 WP_000068176.1.48705 WP_000068176.1.48723 WP_000068176.1.48769 WP_000068176.1.48775 WP_000068176.1.48782 WP_000068176.1.48786 WP_000068176.1.48805 WP_000068176.1.48817 WP_000068176.1.48818 WP_000068176.1.48823 WP_000068176.1.48833 WP_000068176.1.48835 WP_000068176.1.4886 WP_000068176.1.48869 WP_000068176.1.48936 WP_000068176.1.48941 WP_000068176.1.48943 WP_000068176.1.48945 WP_000068176.1.48951 WP_000068176.1.48966 WP_000068176.1.48968 WP_000068176.1.48982 WP_000068176.1.48993 WP_000068176.1.48996 WP_000068176.1.4901 WP_000068176.1.49018 WP_000068176.1.49032 WP_000068176.1.4905 WP_000068176.1.49071 WP_000068176.1.49094 WP_000068176.1.49105 WP_000068176.1.49128 WP_000068176.1.49129 WP_000068176.1.49143 WP_000068176.1.49150 WP_000068176.1.49154 WP_000068176.1.49159 WP_000068176.1.4916 WP_000068176.1.49161 WP_000068176.1.4917 WP_000068176.1.49171 WP_000068176.1.49173 WP_000068176.1.4918 WP_000068176.1.49189 WP_000068176.1.49196 WP_000068176.1.49199 WP_000068176.1.4920 WP_000068176.1.49207 WP_000068176.1.4921 WP_000068176.1.49227 WP_000068176.1.49234 WP_000068176.1.4924 WP_000068176.1.49248 WP_000068176.1.49257 WP_000068176.1.49301 WP_000068176.1.49326 WP_000068176.1.49327 WP_000068176.1.49330 WP_000068176.1.49362 WP_000068176.1.49367 WP_000068176.1.49373 WP_000068176.1.49398 WP_000068176.1.49418 WP_000068176.1.49444 WP_000068176.1.4945 WP_000068176.1.49479 WP_000068176.1.49484 WP_000068176.1.49518 WP_000068176.1.49530 WP_000068176.1.49539 WP_000068176.1.49549 WP_000068176.1.49573 WP_000068176.1.49581 WP_000068176.1.49582 WP_000068176.1.496 WP_000068176.1.49603 WP_000068176.1.49605 WP_000068176.1.4962 WP_000068176.1.49643 WP_000068176.1.49653 WP_000068176.1.49658 WP_000068176.1.49669 WP_000068176.1.49671 WP_000068176.1.49672 WP_000068176.1.49690 WP_000068176.1.49704 WP_000068176.1.49707 WP_000068176.1.49715 WP_000068176.1.49728 WP_000068176.1.49730 WP_000068176.1.49732 WP_000068176.1.49742 WP_000068176.1.49745 WP_000068176.1.4980 WP_000068176.1.49800 WP_000068176.1.49819 WP_000068176.1.4982 WP_000068176.1.49825 WP_000068176.1.4984 WP_000068176.1.49860 WP_000068176.1.49863 WP_000068176.1.4987 WP_000068176.1.49871 WP_000068176.1.4989 WP_000068176.1.49894 WP_000068176.1.49907 WP_000068176.1.49913 WP_000068176.1.49917 WP_000068176.1.49918 WP_000068176.1.49921 WP_000068176.1.49934 WP_000068176.1.49935 WP_000068176.1.49936 WP_000068176.1.4994 WP_000068176.1.49943 WP_000068176.1.49951 WP_000068176.1.49970 WP_000068176.1.49982 WP_000068176.1.50013 WP_000068176.1.50015 WP_000068176.1.50023 WP_000068176.1.50028 WP_000068176.1.50038 WP_000068176.1.50039 WP_000068176.1.50061 WP_000068176.1.50064 WP_000068176.1.50071 WP_000068176.1.50076 WP_000068176.1.50117 WP_000068176.1.5013 WP_000068176.1.50138 WP_000068176.1.50145 WP_000068176.1.50175 WP_000068176.1.50178 WP_000068176.1.50192 WP_000068176.1.50212 WP_000068176.1.50217 WP_000068176.1.50219 WP_000068176.1.50229 WP_000068176.1.50261 WP_000068176.1.50291 WP_000068176.1.50314 WP_000068176.1.5035 WP_000068176.1.50356 WP_000068176.1.50360 WP_000068176.1.50367 WP_000068176.1.50369 WP_000068176.1.50377 WP_000068176.1.50388 WP_000068176.1.50424 WP_000068176.1.50425 WP_000068176.1.50430 WP_000068176.1.50431 WP_000068176.1.50440 WP_000068176.1.5045 WP_000068176.1.50464 WP_000068176.1.50477 WP_000068176.1.50516 WP_000068176.1.50525 WP_000068176.1.50527 WP_000068176.1.50536 WP_000068176.1.50543 WP_000068176.1.50556 WP_000068176.1.50558 WP_000068176.1.50568 WP_000068176.1.50578 WP_000068176.1.5059 WP_000068176.1.50594 WP_000068176.1.50595 WP_000068176.1.50647 WP_000068176.1.50660 WP_000068176.1.50669 WP_000068176.1.50699 WP_000068176.1.50732 WP_000068176.1.50740 WP_000068176.1.50742 WP_000068176.1.50745 WP_000068176.1.50748 WP_000068176.1.50759 WP_000068176.1.50768 WP_000068176.1.50799 WP_000068176.1.5080 WP_000068176.1.50817 WP_000068176.1.50820 WP_000068176.1.50827 WP_000068176.1.50829 WP_000068176.1.5087 WP_000068176.1.50896 WP_000068176.1.50937 WP_000068176.1.50958 WP_000068176.1.50962 WP_000068176.1.50974 WP_000068176.1.51008 WP_000068176.1.51015 WP_000068176.1.51031 WP_000068176.1.51062 WP_000068176.1.5108 WP_000068176.1.51085 WP_000068176.1.5109 WP_000068176.1.5110 WP_000068176.1.5111 WP_000068176.1.51130 WP_000068176.1.51138 WP_000068176.1.51152 WP_000068176.1.5117 WP_000068176.1.51194 WP_000068176.1.51209 WP_000068176.1.51220 WP_000068176.1.51226 WP_000068176.1.51236 WP_000068176.1.51245 WP_000068176.1.51250 WP_000068176.1.51271 WP_000068176.1.51277 WP_000068176.1.51282 WP_000068176.1.51295 WP_000068176.1.51306 WP_000068176.1.51310 WP_000068176.1.51326 WP_000068176.1.51346 WP_000068176.1.51365 WP_000068176.1.51376 WP_000068176.1.51377 WP_000068176.1.51393 WP_000068176.1.51403 WP_000068176.1.51418 WP_000068176.1.5145 WP_000068176.1.51454 WP_000068176.1.51456 WP_000068176.1.51465 WP_000068176.1.51469 WP_000068176.1.51492 WP_000068176.1.51496 WP_000068176.1.51527 WP_000068176.1.5155 WP_000068176.1.51557 WP_000068176.1.51558 WP_000068176.1.51559 WP_000068176.1.51571 WP_000068176.1.51575 WP_000068176.1.51590 WP_000068176.1.51619 WP_000068176.1.51623 WP_000068176.1.51657 WP_000068176.1.51665 WP_000068176.1.51672 WP_000068176.1.51702 WP_000068176.1.51713 WP_000068176.1.51716 WP_000068176.1.51741 WP_000068176.1.51744 WP_000068176.1.51748 WP_000068176.1.51751 WP_000068176.1.51787 WP_000068176.1.51794 WP_000068176.1.51797 WP_000068176.1.51812 WP_000068176.1.51824 WP_000068176.1.51836 WP_000068176.1.51842 WP_000068176.1.51844 WP_000068176.1.5186 WP_000068176.1.51866 WP_000068176.1.51871 WP_000068176.1.51883 WP_000068176.1.5190 WP_000068176.1.51912 WP_000068176.1.51920 WP_000068176.1.51924 WP_000068176.1.51936 WP_000068176.1.51952 WP_000068176.1.51971 WP_000068176.1.51973 WP_000068176.1.51995 WP_000068176.1.52034 WP_000068176.1.52061 WP_000068176.1.52072 WP_000068176.1.52078 WP_000068176.1.5209 WP_000068176.1.521 WP_000068176.1.5213 WP_000068176.1.52151 WP_000068176.1.52162 WP_000068176.1.52182 WP_000068176.1.52193 WP_000068176.1.52195 WP_000068176.1.52198 WP_000068176.1.52210 WP_000068176.1.52224 WP_000068176.1.52251 WP_000068176.1.52252 WP_000068176.1.52259 WP_000068176.1.5228 WP_000068176.1.52289 WP_000068176.1.52296 WP_000068176.1.523 WP_000068176.1.52308 WP_000068176.1.5231 WP_000068176.1.52322 WP_000068176.1.52327 WP_000068176.1.52331 WP_000068176.1.52340 WP_000068176.1.52343 WP_000068176.1.52396 WP_000068176.1.52423 WP_000068176.1.52427 WP_000068176.1.52436 WP_000068176.1.52440 WP_000068176.1.52442 WP_000068176.1.52452 WP_000068176.1.52463 WP_000068176.1.52474 WP_000068176.1.5251 WP_000068176.1.52511 WP_000068176.1.52518 WP_000068176.1.52536 WP_000068176.1.52548 WP_000068176.1.52595 WP_000068176.1.52602 WP_000068176.1.52605 WP_000068176.1.52622 WP_000068176.1.52633 WP_000068176.1.52645 WP_000068176.1.52660 WP_000068176.1.52670 WP_000068176.1.52715 WP_000068176.1.52751 WP_000068176.1.52754 WP_000068176.1.52772 WP_000068176.1.52820 WP_000068176.1.52828 WP_000068176.1.52830 WP_000068176.1.52836 WP_000068176.1.52838 WP_000068176.1.52848 WP_000068176.1.52865 WP_000068176.1.52877 WP_000068176.1.52878 WP_000068176.1.52886 WP_000068176.1.52889 WP_000068176.1.52893 WP_000068176.1.52900 WP_000068176.1.52904 WP_000068176.1.52941 WP_000068176.1.52947 WP_000068176.1.52965 WP_000068176.1.52983 WP_000068176.1.52984 WP_000068176.1.52992 WP_000068176.1.53002 WP_000068176.1.53007 WP_000068176.1.53022 WP_000068176.1.5304 WP_000068176.1.53050 WP_000068176.1.53057 WP_000068176.1.53060 WP_000068176.1.53069 WP_000068176.1.53071 WP_000068176.1.53077 WP_000068176.1.53109 WP_000068176.1.53140 WP_000068176.1.53153 WP_000068176.1.53178 WP_000068176.1.53189 WP_000068176.1.5319 WP_000068176.1.53209 WP_000068176.1.5321 WP_000068176.1.5323 WP_000068176.1.53245 WP_000068176.1.53260 WP_000068176.1.53285 WP_000068176.1.53312 WP_000068176.1.53317 WP_000068176.1.53319 WP_000068176.1.53323 WP_000068176.1.53352 WP_000068176.1.5336 WP_000068176.1.53363 WP_000068176.1.53366 WP_000068176.1.53372 WP_000068176.1.53373 WP_000068176.1.53379 WP_000068176.1.53383 WP_000068176.1.53387 WP_000068176.1.53394 WP_000068176.1.53403 WP_000068176.1.53408 WP_000068176.1.53418 WP_000068176.1.53432 WP_000068176.1.53433 WP_000068176.1.53444 WP_000068176.1.53452 WP_000068176.1.53462 WP_000068176.1.53467 WP_000068176.1.5347 WP_000068176.1.53488 WP_000068176.1.53503 WP_000068176.1.53521 WP_000068176.1.53532 WP_000068176.1.53577 WP_000068176.1.5359 WP_000068176.1.53641 WP_000068176.1.53648 WP_000068176.1.53661 WP_000068176.1.53671 WP_000068176.1.53682 WP_000068176.1.53691 WP_000068176.1.53712 WP_000068176.1.53714 WP_000068176.1.53758 WP_000068176.1.53759 WP_000068176.1.53763 WP_000068176.1.53766 WP_000068176.1.53774 WP_000068176.1.53786 WP_000068176.1.53799 WP_000068176.1.5382 WP_000068176.1.53827 WP_000068176.1.53835 WP_000068176.1.53886 WP_000068176.1.53889 WP_000068176.1.53911 WP_000068176.1.53915 WP_000068176.1.53924 WP_000068176.1.53926 WP_000068176.1.53934 WP_000068176.1.53969 WP_000068176.1.53999 WP_000068176.1.5401 WP_000068176.1.54022 WP_000068176.1.54029 WP_000068176.1.54048 WP_000068176.1.54049 WP_000068176.1.54074 WP_000068176.1.54086 WP_000068176.1.54094 WP_000068176.1.54105 WP_000068176.1.54109 WP_000068176.1.54135 WP_000068176.1.54147 WP_000068176.1.54199 WP_000068176.1.54229 WP_000068176.1.54237 WP_000068176.1.54246 WP_000068176.1.54269 WP_000068176.1.54282 WP_000068176.1.54290 WP_000068176.1.54299 WP_000068176.1.54332 WP_000068176.1.54395 WP_000068176.1.544 WP_000068176.1.54404 WP_000068176.1.54413 WP_000068176.1.54426 WP_000068176.1.54438 WP_000068176.1.54446 WP_000068176.1.54471 WP_000068176.1.54477 WP_000068176.1.54479 WP_000068176.1.54485 WP_000068176.1.54491 WP_000068176.1.54503 WP_000068176.1.54518 WP_000068176.1.54539 WP_000068176.1.54543 WP_000068176.1.54551 WP_000068176.1.54572 WP_000068176.1.54574 WP_000068176.1.54637 WP_000068176.1.54675 WP_000068176.1.54689 WP_000068176.1.5469 WP_000068176.1.54733 WP_000068176.1.54744 WP_000068176.1.54745 WP_000068176.1.54753 WP_000068176.1.54819 WP_000068176.1.54826 WP_000068176.1.54830 WP_000068176.1.54847 WP_000068176.1.54851 WP_000068176.1.54878 WP_000068176.1.54895 WP_000068176.1.54914 WP_000068176.1.54929 WP_000068176.1.54931 WP_000068176.1.54955 WP_000068176.1.54967 WP_000068176.1.54990 WP_000068176.1.54995 WP_000068176.1.5500 WP_000068176.1.55004 WP_000068176.1.55014 WP_000068176.1.55058 WP_000068176.1.55082 WP_000068176.1.55084 WP_000068176.1.55090 WP_000068176.1.55095 WP_000068176.1.55100 WP_000068176.1.55139 WP_000068176.1.5518 WP_000068176.1.5519 WP_000068176.1.55192 WP_000068176.1.552 WP_000068176.1.55220 WP_000068176.1.55239 WP_000068176.1.55271 WP_000068176.1.55272 WP_000068176.1.55274 WP_000068176.1.55301 WP_000068176.1.55306 WP_000068176.1.55309 WP_000068176.1.55327 WP_000068176.1.55336 WP_000068176.1.55352 WP_000068176.1.5536 WP_000068176.1.55367 WP_000068176.1.55369 WP_000068176.1.55403 WP_000068176.1.55405 WP_000068176.1.55419 WP_000068176.1.55421 WP_000068176.1.55442 WP_000068176.1.55495 WP_000068176.1.5550 WP_000068176.1.55508 WP_000068176.1.55527 WP_000068176.1.55535 WP_000068176.1.55538 WP_000068176.1.5554 WP_000068176.1.55544 WP_000068176.1.5556 WP_000068176.1.55573 WP_000068176.1.55583 WP_000068176.1.5559 WP_000068176.1.55603 WP_000068176.1.5562 WP_000068176.1.55620 WP_000068176.1.55628 WP_000068176.1.55637 WP_000068176.1.5565 WP_000068176.1.55653 WP_000068176.1.55657 WP_000068176.1.557 WP_000068176.1.55717 WP_000068176.1.55719 WP_000068176.1.55724 WP_000068176.1.55728 WP_000068176.1.55746 WP_000068176.1.5575 WP_000068176.1.55784 WP_000068176.1.55786 WP_000068176.1.5580 WP_000068176.1.55818 WP_000068176.1.55831 WP_000068176.1.55835 WP_000068176.1.55839 WP_000068176.1.55845 WP_000068176.1.55848 WP_000068176.1.55854 WP_000068176.1.55859 WP_000068176.1.55867 WP_000068176.1.55874 WP_000068176.1.55886 WP_000068176.1.5589 WP_000068176.1.5590 WP_000068176.1.55904 WP_000068176.1.55916 WP_000068176.1.55933 WP_000068176.1.55949 WP_000068176.1.55953 WP_000068176.1.55955 WP_000068176.1.55960 WP_000068176.1.55985 WP_000068176.1.55991 WP_000068176.1.56000 WP_000068176.1.56003 WP_000068176.1.56025 WP_000068176.1.56039 WP_000068176.1.5604 WP_000068176.1.56048 WP_000068176.1.5606 WP_000068176.1.56064 WP_000068176.1.56078 WP_000068176.1.56098 WP_000068176.1.56099 WP_000068176.1.56106 WP_000068176.1.56135 WP_000068176.1.56153 WP_000068176.1.56159 WP_000068176.1.56200 WP_000068176.1.56210 WP_000068176.1.56213 WP_000068176.1.56214 WP_000068176.1.56220 WP_000068176.1.56225 WP_000068176.1.5623 WP_000068176.1.56237 WP_000068176.1.56239 WP_000068176.1.56241 WP_000068176.1.56260 WP_000068176.1.56265 WP_000068176.1.56272 WP_000068176.1.56275 WP_000068176.1.56281 WP_000068176.1.56306 WP_000068176.1.56332 WP_000068176.1.56333 WP_000068176.1.56343 WP_000068176.1.5635 WP_000068176.1.56364 WP_000068176.1.5637 WP_000068176.1.56377 WP_000068176.1.56387 WP_000068176.1.56400 WP_000068176.1.5644 WP_000068176.1.56444 WP_000068176.1.56453 WP_000068176.1.56464 WP_000068176.1.56482 WP_000068176.1.56496 WP_000068176.1.56522 WP_000068176.1.56525 WP_000068176.1.56527 WP_000068176.1.56530 WP_000068176.1.56542 WP_000068176.1.56558 WP_000068176.1.56570 WP_000068176.1.5658 WP_000068176.1.56584 WP_000068176.1.566 WP_000068176.1.56608 WP_000068176.1.56619 WP_000068176.1.56628 WP_000068176.1.56641 WP_000068176.1.5665 WP_000068176.1.56658 WP_000068176.1.56679 WP_000068176.1.56696 WP_000068176.1.56702 WP_000068176.1.56708 WP_000068176.1.56722 WP_000068176.1.56723 WP_000068176.1.56737 WP_000068176.1.5675 WP_000068176.1.56767 WP_000068176.1.5677 WP_000068176.1.56772 WP_000068176.1.56779 WP_000068176.1.56794 WP_000068176.1.56803 WP_000068176.1.56806 WP_000068176.1.56815 WP_000068176.1.56822 WP_000068176.1.56856 WP_000068176.1.5686 WP_000068176.1.56865 WP_000068176.1.56878 WP_000068176.1.56903 WP_000068176.1.56931 WP_000068176.1.56966 WP_000068176.1.56967 WP_000068176.1.56975 WP_000068176.1.56986 WP_000068176.1.57015 WP_000068176.1.57024 WP_000068176.1.5705 WP_000068176.1.57073 WP_000068176.1.57075 WP_000068176.1.57080 WP_000068176.1.57081 WP_000068176.1.57097 WP_000068176.1.57102 WP_000068176.1.57109 WP_000068176.1.57115 WP_000068176.1.57141 WP_000068176.1.57158 WP_000068176.1.57170 WP_000068176.1.57175 WP_000068176.1.5718 WP_000068176.1.57190 WP_000068176.1.57196 WP_000068176.1.57214 WP_000068176.1.57223 WP_000068176.1.57265 WP_000068176.1.57271 WP_000068176.1.57291 WP_000068176.1.57309 WP_000068176.1.57316 WP_000068176.1.57330 WP_000068176.1.57338 WP_000068176.1.5735 WP_000068176.1.57370 WP_000068176.1.57376 WP_000068176.1.57385 WP_000068176.1.57389 WP_000068176.1.57427 WP_000068176.1.5743 WP_000068176.1.57445 WP_000068176.1.57448 WP_000068176.1.57459 WP_000068176.1.57481 WP_000068176.1.5749 WP_000068176.1.57507 WP_000068176.1.5752 WP_000068176.1.57577 WP_000068176.1.57593 WP_000068176.1.57594 WP_000068176.1.57612 WP_000068176.1.57614 WP_000068176.1.5763 WP_000068176.1.57635 WP_000068176.1.57650 WP_000068176.1.57665 WP_000068176.1.57670 WP_000068176.1.57682 WP_000068176.1.57692 WP_000068176.1.57693 WP_000068176.1.5770 WP_000068176.1.57701 WP_000068176.1.57718 WP_000068176.1.57720 WP_000068176.1.57723 WP_000068176.1.57727 WP_000068176.1.57730 WP_000068176.1.57734 WP_000068176.1.57745 WP_000068176.1.57754 WP_000068176.1.57761 WP_000068176.1.57770 WP_000068176.1.57783 WP_000068176.1.57808 WP_000068176.1.57819 WP_000068176.1.57837 WP_000068176.1.57840 WP_000068176.1.57844 WP_000068176.1.57861 WP_000068176.1.57875 WP_000068176.1.57883 WP_000068176.1.57888 WP_000068176.1.579 WP_000068176.1.57910 WP_000068176.1.57915 WP_000068176.1.57928 WP_000068176.1.57943 WP_000068176.1.57944 WP_000068176.1.57952 WP_000068176.1.57962 WP_000068176.1.57974 WP_000068176.1.5799 WP_000068176.1.58005 WP_000068176.1.58006 WP_000068176.1.58014 WP_000068176.1.58016 WP_000068176.1.58017 WP_000068176.1.58035 WP_000068176.1.58042 WP_000068176.1.58049 WP_000068176.1.58050 WP_000068176.1.58051 WP_000068176.1.58074 WP_000068176.1.58106 WP_000068176.1.58116 WP_000068176.1.58122 WP_000068176.1.58127 WP_000068176.1.58139 WP_000068176.1.58148 WP_000068176.1.58158 WP_000068176.1.5816 WP_000068176.1.5817 WP_000068176.1.58175 WP_000068176.1.58185 WP_000068176.1.58198 WP_000068176.1.58212 WP_000068176.1.58241 WP_000068176.1.58242 WP_000068176.1.58246 WP_000068176.1.5827 WP_000068176.1.58277 WP_000068176.1.58317 WP_000068176.1.5832 WP_000068176.1.58321 WP_000068176.1.58325 WP_000068176.1.58350 WP_000068176.1.58352 WP_000068176.1.58353 WP_000068176.1.58364 WP_000068176.1.58366 WP_000068176.1.58373 WP_000068176.1.58388 WP_000068176.1.58392 WP_000068176.1.58395 WP_000068176.1.58413 WP_000068176.1.58419 WP_000068176.1.58421 WP_000068176.1.58430 WP_000068176.1.58435 WP_000068176.1.58473 WP_000068176.1.58481 WP_000068176.1.5849 WP_000068176.1.58495 WP_000068176.1.58497 WP_000068176.1.58504 WP_000068176.1.58508 WP_000068176.1.58512 WP_000068176.1.58521 WP_000068176.1.58530 WP_000068176.1.58538 WP_000068176.1.58549 WP_000068176.1.5857 WP_000068176.1.58571 WP_000068176.1.58584 WP_000068176.1.58588 WP_000068176.1.58592 WP_000068176.1.58598 WP_000068176.1.586 WP_000068176.1.58603 WP_000068176.1.58686 WP_000068176.1.58701 WP_000068176.1.58704 WP_000068176.1.58714 WP_000068176.1.58718 WP_000068176.1.58735 WP_000068176.1.58760 WP_000068176.1.58763 WP_000068176.1.58772 WP_000068176.1.58775 WP_000068176.1.58798 WP_000068176.1.5880 WP_000068176.1.58833 WP_000068176.1.58839 WP_000068176.1.58855 WP_000068176.1.58860 WP_000068176.1.58934 WP_000068176.1.58936 WP_000068176.1.58960 WP_000068176.1.58981 WP_000068176.1.58991 WP_000068176.1.58998 WP_000068176.1.59011 WP_000068176.1.59014 WP_000068176.1.59039 WP_000068176.1.5904 WP_000068176.1.59046 WP_000068176.1.59062 WP_000068176.1.59077 WP_000068176.1.59098 WP_000068176.1.59124 WP_000068176.1.59133 WP_000068176.1.59135 WP_000068176.1.59146 WP_000068176.1.59157 WP_000068176.1.59175 WP_000068176.1.59178 WP_000068176.1.59187 WP_000068176.1.5920 WP_000068176.1.59203 WP_000068176.1.59213 WP_000068176.1.5925 WP_000068176.1.59269 WP_000068176.1.59284 WP_000068176.1.5930 WP_000068176.1.59311 WP_000068176.1.59327 WP_000068176.1.59329 WP_000068176.1.59334 WP_000068176.1.59337 WP_000068176.1.59363 WP_000068176.1.5938 WP_000068176.1.59380 WP_000068176.1.59397 WP_000068176.1.59398 WP_000068176.1.59401 WP_000068176.1.59404 WP_000068176.1.59414 WP_000068176.1.59441 WP_000068176.1.59457 WP_000068176.1.59459 WP_000068176.1.59462 WP_000068176.1.59464 WP_000068176.1.59467 WP_000068176.1.59478 WP_000068176.1.59540 WP_000068176.1.59546 WP_000068176.1.59547 WP_000068176.1.59567 WP_000068176.1.59594 WP_000068176.1.59598 WP_000068176.1.59603 WP_000068176.1.59624 WP_000068176.1.59629 WP_000068176.1.59643 WP_000068176.1.59663 WP_000068176.1.59668 WP_000068176.1.59669 WP_000068176.1.59671 WP_000068176.1.59697 WP_000068176.1.5972 WP_000068176.1.59736 WP_000068176.1.59803 WP_000068176.1.59810 WP_000068176.1.59819 WP_000068176.1.5982 WP_000068176.1.59822 WP_000068176.1.59864 WP_000068176.1.59874 WP_000068176.1.59881 WP_000068176.1.59886 WP_000068176.1.59896 WP_000068176.1.59907 WP_000068176.1.59915 WP_000068176.1.59921 WP_000068176.1.59945 WP_000068176.1.59977 WP_000068176.1.60001 WP_000068176.1.60006 WP_000068176.1.60022 WP_000068176.1.60086 WP_000068176.1.60101 WP_000068176.1.60107 WP_000068176.1.6011 WP_000068176.1.60118 WP_000068176.1.60123 WP_000068176.1.60124 WP_000068176.1.60147 WP_000068176.1.60149 WP_000068176.1.60156 WP_000068176.1.60157 WP_000068176.1.60158 WP_000068176.1.60165 WP_000068176.1.6017 WP_000068176.1.60181 WP_000068176.1.602 WP_000068176.1.60201 WP_000068176.1.60227 WP_000068176.1.60251 WP_000068176.1.60259 WP_000068176.1.60280 WP_000068176.1.60289 WP_000068176.1.60302 WP_000068176.1.60307 WP_000068176.1.60339 WP_000068176.1.6034 WP_000068176.1.60345 WP_000068176.1.60353 WP_000068176.1.60355 WP_000068176.1.60368 WP_000068176.1.60382 WP_000068176.1.60414 WP_000068176.1.60431 WP_000068176.1.60434 WP_000068176.1.6045 WP_000068176.1.60462 WP_000068176.1.60473 WP_000068176.1.60493 WP_000068176.1.60515 WP_000068176.1.60530 WP_000068176.1.60547 WP_000068176.1.60551 WP_000068176.1.60585 WP_000068176.1.60594 WP_000068176.1.60595 WP_000068176.1.60641 WP_000068176.1.60675 WP_000068176.1.60677 WP_000068176.1.60690 WP_000068176.1.60696 WP_000068176.1.60704 WP_000068176.1.60719 WP_000068176.1.60730 WP_000068176.1.60734 WP_000068176.1.60742 WP_000068176.1.60750 WP_000068176.1.60751 WP_000068176.1.60759 WP_000068176.1.60765 WP_000068176.1.60778 WP_000068176.1.60787 WP_000068176.1.60813 WP_000068176.1.60820 WP_000068176.1.60845 WP_000068176.1.6085 WP_000068176.1.60859 WP_000068176.1.60869 WP_000068176.1.60888 WP_000068176.1.60898 WP_000068176.1.60912 WP_000068176.1.60917 WP_000068176.1.60923 WP_000068176.1.60934 WP_000068176.1.60939 WP_000068176.1.60943 WP_000068176.1.60946 WP_000068176.1.60948 WP_000068176.1.60949 WP_000068176.1.60965 WP_000068176.1.60981 WP_000068176.1.60982 WP_000068176.1.60991 WP_000068176.1.61009 WP_000068176.1.61013 WP_000068176.1.61019 WP_000068176.1.61023 WP_000068176.1.61026 WP_000068176.1.61029 WP_000068176.1.61030 WP_000068176.1.61031 WP_000068176.1.61077 WP_000068176.1.61115 WP_000068176.1.61119 WP_000068176.1.61139 WP_000068176.1.61152 WP_000068176.1.61153 WP_000068176.1.6118 WP_000068176.1.61187 WP_000068176.1.61188 WP_000068176.1.61189 WP_000068176.1.6119 WP_000068176.1.61215 WP_000068176.1.61224 WP_000068176.1.6123 WP_000068176.1.61257 WP_000068176.1.61261 WP_000068176.1.61263 WP_000068176.1.61271 WP_000068176.1.61277 WP_000068176.1.61286 WP_000068176.1.61289 WP_000068176.1.61313 WP_000068176.1.61316 WP_000068176.1.61318 WP_000068176.1.61324 WP_000068176.1.61327 WP_000068176.1.61339 WP_000068176.1.61346 WP_000068176.1.61353 WP_000068176.1.6136 WP_000068176.1.61375 WP_000068176.1.61393 WP_000068176.1.61394 WP_000068176.1.61408 WP_000068176.1.61413 WP_000068176.1.61421 WP_000068176.1.61439 WP_000068176.1.61440 WP_000068176.1.6149 WP_000068176.1.61515 WP_000068176.1.61534 WP_000068176.1.61547 WP_000068176.1.61555 WP_000068176.1.61564 WP_000068176.1.61585 WP_000068176.1.61591 WP_000068176.1.61597 WP_000068176.1.61639 WP_000068176.1.61641 WP_000068176.1.61653 WP_000068176.1.6166 WP_000068176.1.6168 WP_000068176.1.61687 WP_000068176.1.6170 WP_000068176.1.61705 WP_000068176.1.61709 WP_000068176.1.61713 WP_000068176.1.61747 WP_000068176.1.61749 WP_000068176.1.61776 WP_000068176.1.61784 WP_000068176.1.61802 WP_000068176.1.61838 WP_000068176.1.61843 WP_000068176.1.61864 WP_000068176.1.6188 WP_000068176.1.6189 WP_000068176.1.61897 WP_000068176.1.61899 WP_000068176.1.619 WP_000068176.1.61903 WP_000068176.1.61910 WP_000068176.1.61921 WP_000068176.1.61936 WP_000068176.1.61962 WP_000068176.1.61970 WP_000068176.1.61975 WP_000068176.1.61976 WP_000068176.1.61978 WP_000068176.1.62002 WP_000068176.1.6201 WP_000068176.1.62028 WP_000068176.1.62030 WP_000068176.1.62069 WP_000068176.1.62071 WP_000068176.1.6208 WP_000068176.1.62084 WP_000068176.1.62085 WP_000068176.1.62088 WP_000068176.1.62093 WP_000068176.1.62096 WP_000068176.1.62127 WP_000068176.1.62140 WP_000068176.1.62160 WP_000068176.1.62164 WP_000068176.1.62229 WP_000068176.1.62247 WP_000068176.1.62253 WP_000068176.1.62254 WP_000068176.1.62265 WP_000068176.1.62318 WP_000068176.1.6234 WP_000068176.1.62346 WP_000068176.1.62352 WP_000068176.1.62367 WP_000068176.1.62382 WP_000068176.1.62383 WP_000068176.1.62392 WP_000068176.1.62398 WP_000068176.1.62409 WP_000068176.1.62414 WP_000068176.1.62429 WP_000068176.1.62437 WP_000068176.1.62453 WP_000068176.1.62459 WP_000068176.1.62462 WP_000068176.1.62474 WP_000068176.1.62482 WP_000068176.1.62492 WP_000068176.1.62496 WP_000068176.1.6250 WP_000068176.1.62537 WP_000068176.1.62539 WP_000068176.1.62553 WP_000068176.1.62563 WP_000068176.1.62575 WP_000068176.1.62602 WP_000068176.1.62608 WP_000068176.1.62621 WP_000068176.1.62625 WP_000068176.1.62630 WP_000068176.1.62653 WP_000068176.1.6266 WP_000068176.1.62671 WP_000068176.1.62674 WP_000068176.1.6268 WP_000068176.1.62684 WP_000068176.1.62685 WP_000068176.1.62723 WP_000068176.1.62740 WP_000068176.1.62756 WP_000068176.1.62764 WP_000068176.1.62771 WP_000068176.1.62781 WP_000068176.1.62796 WP_000068176.1.62808 WP_000068176.1.62822 WP_000068176.1.62824 WP_000068176.1.62829 WP_000068176.1.62831 WP_000068176.1.62842 WP_000068176.1.62860 WP_000068176.1.62863 WP_000068176.1.62878 WP_000068176.1.62880 WP_000068176.1.62925 WP_000068176.1.62927 WP_000068176.1.62956 WP_000068176.1.62970 WP_000068176.1.62974 WP_000068176.1.6298 WP_000068176.1.62998 WP_000068176.1.63003 WP_000068176.1.63004 WP_000068176.1.63011 WP_000068176.1.63021 WP_000068176.1.63027 WP_000068176.1.63040 WP_000068176.1.63047 WP_000068176.1.63050 WP_000068176.1.63051 WP_000068176.1.63052 WP_000068176.1.63062 WP_000068176.1.63068 WP_000068176.1.63070 WP_000068176.1.63083 WP_000068176.1.63085 WP_000068176.1.631 WP_000068176.1.63107 WP_000068176.1.63120 WP_000068176.1.63131 WP_000068176.1.63139 WP_000068176.1.63140 WP_000068176.1.63142 WP_000068176.1.63143 WP_000068176.1.63162 WP_000068176.1.63170 WP_000068176.1.63182 WP_000068176.1.63190 WP_000068176.1.63195 WP_000068176.1.63215 WP_000068176.1.63220 WP_000068176.1.63228 WP_000068176.1.63233 WP_000068176.1.63244 WP_000068176.1.63255 WP_000068176.1.63266 WP_000068176.1.63273 WP_000068176.1.63279 WP_000068176.1.63280 WP_000068176.1.63288 WP_000068176.1.63289 WP_000068176.1.63296 WP_000068176.1.63304 WP_000068176.1.63307 WP_000068176.1.63313 WP_000068176.1.63319 WP_000068176.1.63322 WP_000068176.1.63324 WP_000068176.1.63333 WP_000068176.1.63335 WP_000068176.1.63337 WP_000068176.1.63341 WP_000068176.1.63364 WP_000068176.1.63365 WP_000068176.1.63383 WP_000068176.1.634 WP_000068176.1.63406 WP_000068176.1.63411 WP_000068176.1.63421 WP_000068176.1.63441 WP_000068176.1.63460 WP_000068176.1.63469 WP_000068176.1.63471 WP_000068176.1.63510 WP_000068176.1.63527 WP_000068176.1.63540 WP_000068176.1.6355 WP_000068176.1.63565 WP_000068176.1.63589 WP_000068176.1.63617 WP_000068176.1.63635 WP_000068176.1.63672 WP_000068176.1.63673 WP_000068176.1.63693 WP_000068176.1.63704 WP_000068176.1.63705 WP_000068176.1.63726 WP_000068176.1.63729 WP_000068176.1.6374 WP_000068176.1.63751 WP_000068176.1.63759 WP_000068176.1.63760 WP_000068176.1.63763 WP_000068176.1.63774 WP_000068176.1.6378 WP_000068176.1.63828 WP_000068176.1.63847 WP_000068176.1.63874 WP_000068176.1.6388 WP_000068176.1.63890 WP_000068176.1.63894 WP_000068176.1.63895 WP_000068176.1.63907 WP_000068176.1.63910 WP_000068176.1.63923 WP_000068176.1.63937 WP_000068176.1.63947 WP_000068176.1.63975 WP_000068176.1.63978 WP_000068176.1.63987 WP_000068176.1.63998 WP_000068176.1.64012 WP_000068176.1.6403 WP_000068176.1.64060 WP_000068176.1.6408 WP_000068176.1.64094 WP_000068176.1.64105 WP_000068176.1.64108 WP_000068176.1.6412 WP_000068176.1.64127 WP_000068176.1.64181 WP_000068176.1.64192 WP_000068176.1.642 WP_000068176.1.64207 WP_000068176.1.64230 WP_000068176.1.64232 WP_000068176.1.64234 WP_000068176.1.64250 WP_000068176.1.64251 WP_000068176.1.64279 WP_000068176.1.64303 WP_000068176.1.64304 WP_000068176.1.64334 WP_000068176.1.64351 WP_000068176.1.64367 WP_000068176.1.64368 WP_000068176.1.6438 WP_000068176.1.64396 WP_000068176.1.64397 WP_000068176.1.64400 WP_000068176.1.64408 WP_000068176.1.64434 WP_000068176.1.64440 WP_000068176.1.64446 WP_000068176.1.64456 WP_000068176.1.64457 WP_000068176.1.64473 WP_000068176.1.645 WP_000068176.1.64525 WP_000068176.1.6453 WP_000068176.1.64537 WP_000068176.1.64549 WP_000068176.1.64565 WP_000068176.1.64583 WP_000068176.1.6459 WP_000068176.1.64598 WP_000068176.1.6462 WP_000068176.1.64628 WP_000068176.1.64630 WP_000068176.1.64631 WP_000068176.1.64643 WP_000068176.1.64665 WP_000068176.1.64677 WP_000068176.1.64686 WP_000068176.1.64720 WP_000068176.1.64765 WP_000068176.1.6479 WP_000068176.1.64811 WP_000068176.1.64845 WP_000068176.1.64858 WP_000068176.1.64860 WP_000068176.1.64873 WP_000068176.1.64879 WP_000068176.1.6488 WP_000068176.1.64893 WP_000068176.1.64896 WP_000068176.1.64897 WP_000068176.1.64899 WP_000068176.1.64911 WP_000068176.1.64935 WP_000068176.1.64951 WP_000068176.1.64956 WP_000068176.1.64961 WP_000068176.1.64988 WP_000068176.1.64994 WP_000068176.1.64996 WP_000068176.1.64998 WP_000068176.1.65025 WP_000068176.1.65033 WP_000068176.1.65038 WP_000068176.1.65044 WP_000068176.1.65046 WP_000068176.1.65076 WP_000068176.1.65082 WP_000068176.1.6509 WP_000068176.1.65125 WP_000068176.1.65132 WP_000068176.1.65153 WP_000068176.1.65156 WP_000068176.1.65158 WP_000068176.1.65164 WP_000068176.1.65180 WP_000068176.1.65193 WP_000068176.1.65203 WP_000068176.1.65214 WP_000068176.1.65217 WP_000068176.1.65233 WP_000068176.1.65259 WP_000068176.1.65264 WP_000068176.1.65274 WP_000068176.1.6531 WP_000068176.1.65317 WP_000068176.1.65346 WP_000068176.1.65358 WP_000068176.1.65361 WP_000068176.1.65367 WP_000068176.1.65387 WP_000068176.1.65406 WP_000068176.1.65407 WP_000068176.1.65419 WP_000068176.1.65423 WP_000068176.1.65432 WP_000068176.1.6544 WP_000068176.1.65443 WP_000068176.1.65448 WP_000068176.1.65451 WP_000068176.1.6547 WP_000068176.1.65470 WP_000068176.1.65504 WP_000068176.1.6551 WP_000068176.1.65512 WP_000068176.1.65520 WP_000068176.1.65541 WP_000068176.1.65544 WP_000068176.1.65555 WP_000068176.1.65562 WP_000068176.1.65585 WP_000068176.1.6559 WP_000068176.1.65599 WP_000068176.1.65600 WP_000068176.1.65616 WP_000068176.1.65629 WP_000068176.1.65643 WP_000068176.1.65653 WP_000068176.1.65656 WP_000068176.1.65663 WP_000068176.1.65675 WP_000068176.1.6568 WP_000068176.1.65689 WP_000068176.1.65693 WP_000068176.1.65700 WP_000068176.1.65703 WP_000068176.1.65704 WP_000068176.1.65705 WP_000068176.1.65713 WP_000068176.1.65717 WP_000068176.1.65734 WP_000068176.1.65750 WP_000068176.1.65752 WP_000068176.1.65769 WP_000068176.1.6578 WP_000068176.1.65808 WP_000068176.1.65842 WP_000068176.1.6585 WP_000068176.1.65856 WP_000068176.1.65870 WP_000068176.1.65879 WP_000068176.1.65886 WP_000068176.1.65892 WP_000068176.1.65922 WP_000068176.1.65928 WP_000068176.1.65930 WP_000068176.1.65935 WP_000068176.1.65946 WP_000068176.1.65947 WP_000068176.1.65948 WP_000068176.1.65965 WP_000068176.1.65986 WP_000068176.1.65990 WP_000068176.1.66009 WP_000068176.1.66014 WP_000068176.1.6603 WP_000068176.1.66035 WP_000068176.1.66054 WP_000068176.1.66069 WP_000068176.1.66073 WP_000068176.1.66081 WP_000068176.1.6612 WP_000068176.1.66120 WP_000068176.1.66130 WP_000068176.1.66133 WP_000068176.1.66144 WP_000068176.1.66175 WP_000068176.1.66227 WP_000068176.1.66262 WP_000068176.1.66265 WP_000068176.1.66281 WP_000068176.1.66287 WP_000068176.1.66298 WP_000068176.1.66302 WP_000068176.1.6632 WP_000068176.1.66322 WP_000068176.1.66328 WP_000068176.1.66366 WP_000068176.1.66369 WP_000068176.1.66433 WP_000068176.1.66453 WP_000068176.1.66482 WP_000068176.1.66505 WP_000068176.1.66513 WP_000068176.1.66518 WP_000068176.1.66519 WP_000068176.1.66542 WP_000068176.1.66554 WP_000068176.1.66556 WP_000068176.1.66564 WP_000068176.1.66576 WP_000068176.1.66588 WP_000068176.1.66598 WP_000068176.1.66601 WP_000068176.1.66606 WP_000068176.1.66611 WP_000068176.1.66614 WP_000068176.1.6662 WP_000068176.1.66628 WP_000068176.1.66645 WP_000068176.1.66655 WP_000068176.1.66664 WP_000068176.1.66677 WP_000068176.1.6668 WP_000068176.1.66690 WP_000068176.1.66705 WP_000068176.1.66711 WP_000068176.1.66712 WP_000068176.1.66726 WP_000068176.1.6674 WP_000068176.1.66756 WP_000068176.1.66765 WP_000068176.1.66766 WP_000068176.1.66786 WP_000068176.1.66792 WP_000068176.1.66803 WP_000068176.1.66816 WP_000068176.1.66818 WP_000068176.1.6684 WP_000068176.1.66853 WP_000068176.1.66879 WP_000068176.1.6688 WP_000068176.1.66904 WP_000068176.1.66906 WP_000068176.1.66938 WP_000068176.1.66969 WP_000068176.1.66979 WP_000068176.1.66996 WP_000068176.1.6700 WP_000068176.1.67006 WP_000068176.1.67012 WP_000068176.1.67014 WP_000068176.1.67016 WP_000068176.1.67063 WP_000068176.1.67067 WP_000068176.1.67072 WP_000068176.1.67090 WP_000068176.1.67112 WP_000068176.1.67113 WP_000068176.1.67135 WP_000068176.1.67147 WP_000068176.1.67152 WP_000068176.1.67155 WP_000068176.1.67160 WP_000068176.1.67191 WP_000068176.1.67204 WP_000068176.1.67212 WP_000068176.1.6722 WP_000068176.1.67238 WP_000068176.1.67251 WP_000068176.1.67259 WP_000068176.1.6726 WP_000068176.1.67266 WP_000068176.1.67286 WP_000068176.1.67294 WP_000068176.1.67296 WP_000068176.1.67297 WP_000068176.1.67312 WP_000068176.1.67328 WP_000068176.1.67329 WP_000068176.1.67333 WP_000068176.1.67375 WP_000068176.1.67379 WP_000068176.1.67386 WP_000068176.1.6740 WP_000068176.1.67414 WP_000068176.1.67418 WP_000068176.1.67420 WP_000068176.1.67425 WP_000068176.1.67447 WP_000068176.1.67457 WP_000068176.1.67460 WP_000068176.1.67463 WP_000068176.1.67480 WP_000068176.1.67505 WP_000068176.1.67507 WP_000068176.1.67513 WP_000068176.1.67521 WP_000068176.1.67540 WP_000068176.1.67554 WP_000068176.1.67571 WP_000068176.1.67572 WP_000068176.1.67609 WP_000068176.1.67612 WP_000068176.1.67618 WP_000068176.1.67620 WP_000068176.1.67621 WP_000068176.1.67632 WP_000068176.1.67644 WP_000068176.1.67651 WP_000068176.1.67652 WP_000068176.1.67653 WP_000068176.1.67691 WP_000068176.1.67703 WP_000068176.1.67712 WP_000068176.1.67713 WP_000068176.1.67722 WP_000068176.1.67752 WP_000068176.1.67754 WP_000068176.1.67762 WP_000068176.1.67767 WP_000068176.1.67798 WP_000068176.1.67800 WP_000068176.1.67806 WP_000068176.1.67808 WP_000068176.1.67815 WP_000068176.1.67834 WP_000068176.1.6786 WP_000068176.1.67864 WP_000068176.1.67865 WP_000068176.1.67867 WP_000068176.1.67880 WP_000068176.1.67889 WP_000068176.1.67900 WP_000068176.1.67925 WP_000068176.1.67931 WP_000068176.1.67941 WP_000068176.1.67986 WP_000068176.1.67991 WP_000068176.1.68001 WP_000068176.1.68020 WP_000068176.1.68033 WP_000068176.1.68054 WP_000068176.1.68066 WP_000068176.1.68101 WP_000068176.1.68102 WP_000068176.1.6811 WP_000068176.1.68111 WP_000068176.1.68134 WP_000068176.1.68139 WP_000068176.1.68141 WP_000068176.1.68152 WP_000068176.1.68160 WP_000068176.1.68161 WP_000068176.1.68199 WP_000068176.1.68202 WP_000068176.1.68219 WP_000068176.1.68221 WP_000068176.1.68223 WP_000068176.1.68233 WP_000068176.1.6824 WP_000068176.1.68261 WP_000068176.1.68268 WP_000068176.1.68286 WP_000068176.1.68295 WP_000068176.1.68296 WP_000068176.1.68299 WP_000068176.1.6830 WP_000068176.1.68307 WP_000068176.1.68334 WP_000068176.1.6834 WP_000068176.1.68343 WP_000068176.1.68351 WP_000068176.1.68355 WP_000068176.1.68366 WP_000068176.1.68367 WP_000068176.1.68392 WP_000068176.1.68398 WP_000068176.1.68399 WP_000068176.1.68404 WP_000068176.1.68416 WP_000068176.1.68425 WP_000068176.1.68466 WP_000068176.1.68476 WP_000068176.1.68479 WP_000068176.1.68483 WP_000068176.1.68489 WP_000068176.1.68504 WP_000068176.1.68505 WP_000068176.1.68512 WP_000068176.1.68522 WP_000068176.1.68542 WP_000068176.1.68548 WP_000068176.1.68565 WP_000068176.1.68575 WP_000068176.1.686 WP_000068176.1.68636 WP_000068176.1.68650 WP_000068176.1.68657 WP_000068176.1.68681 WP_000068176.1.68683 WP_000068176.1.68699 WP_000068176.1.68703 WP_000068176.1.68716 WP_000068176.1.68728 WP_000068176.1.68741 WP_000068176.1.68743 WP_000068176.1.68747 WP_000068176.1.68773 WP_000068176.1.68775 WP_000068176.1.68813 WP_000068176.1.68831 WP_000068176.1.68854 WP_000068176.1.68864 WP_000068176.1.68875 WP_000068176.1.68878 WP_000068176.1.68883 WP_000068176.1.68917 WP_000068176.1.68931 WP_000068176.1.68943 WP_000068176.1.68944 WP_000068176.1.68987 WP_000068176.1.68988 WP_000068176.1.68998 WP_000068176.1.69012 WP_000068176.1.69016 WP_000068176.1.69045 WP_000068176.1.69071 WP_000068176.1.69078 WP_000068176.1.69087 WP_000068176.1.69089 WP_000068176.1.69105 WP_000068176.1.69110 WP_000068176.1.69111 WP_000068176.1.69125 WP_000068176.1.69147 WP_000068176.1.6915 WP_000068176.1.69162 WP_000068176.1.6917 WP_000068176.1.69179 WP_000068176.1.69191 WP_000068176.1.69198 WP_000068176.1.69219 WP_000068176.1.69232 WP_000068176.1.69237 WP_000068176.1.69239 WP_000068176.1.69251 WP_000068176.1.69266 WP_000068176.1.69280 WP_000068176.1.69314 WP_000068176.1.69349 WP_000068176.1.69361 WP_000068176.1.69366 WP_000068176.1.69378 WP_000068176.1.69394 WP_000068176.1.69395 WP_000068176.1.69409 WP_000068176.1.69412 WP_000068176.1.69415 WP_000068176.1.69434 WP_000068176.1.69437 WP_000068176.1.69446 WP_000068176.1.69475 WP_000068176.1.69476 WP_000068176.1.69477 WP_000068176.1.69480 WP_000068176.1.69483 WP_000068176.1.69484 WP_000068176.1.69489 WP_000068176.1.69490 WP_000068176.1.695 WP_000068176.1.69520 WP_000068176.1.6953 WP_000068176.1.69546 WP_000068176.1.69559 WP_000068176.1.69563 WP_000068176.1.69598 WP_000068176.1.69622 WP_000068176.1.69639 WP_000068176.1.69679 WP_000068176.1.6968 WP_000068176.1.69683 WP_000068176.1.69685 WP_000068176.1.69718 WP_000068176.1.69721 WP_000068176.1.69724 WP_000068176.1.69734 WP_000068176.1.6980 WP_000068176.1.69820 WP_000068176.1.69823 WP_000068176.1.69830 WP_000068176.1.69842 WP_000068176.1.69877 WP_000068176.1.69878 WP_000068176.1.69882 WP_000068176.1.699 WP_000068176.1.69902 WP_000068176.1.69921 WP_000068176.1.69934 WP_000068176.1.69980 WP_000068176.1.69987 WP_000068176.1.69995 WP_000068176.1.70024 WP_000068176.1.70048 WP_000068176.1.70059 WP_000068176.1.70089 WP_000068176.1.70094 WP_000068176.1.70105 WP_000068176.1.7012 WP_000068176.1.70133 WP_000068176.1.70161 WP_000068176.1.70210 WP_000068176.1.70220 WP_000068176.1.70225 WP_000068176.1.70228 WP_000068176.1.7024 WP_000068176.1.70253 WP_000068176.1.70266 WP_000068176.1.70294 WP_000068176.1.703 WP_000068176.1.7030 WP_000068176.1.70311 WP_000068176.1.70313 WP_000068176.1.70338 WP_000068176.1.7034 WP_000068176.1.70344 WP_000068176.1.70349 WP_000068176.1.70353 WP_000068176.1.70361 WP_000068176.1.70389 WP_000068176.1.70413 WP_000068176.1.7043 WP_000068176.1.70438 WP_000068176.1.70441 WP_000068176.1.70448 WP_000068176.1.70451 WP_000068176.1.70457 WP_000068176.1.70459 WP_000068176.1.7046 WP_000068176.1.70487 WP_000068176.1.70495 WP_000068176.1.70527 WP_000068176.1.70541 WP_000068176.1.70546 WP_000068176.1.70554 WP_000068176.1.70558 WP_000068176.1.70564 WP_000068176.1.70572 WP_000068176.1.706 WP_000068176.1.7061 WP_000068176.1.70611 WP_000068176.1.70635 WP_000068176.1.7064 WP_000068176.1.70641 WP_000068176.1.70651 WP_000068176.1.70664 WP_000068176.1.70672 WP_000068176.1.707 WP_000068176.1.7071 WP_000068176.1.70721 WP_000068176.1.7073 WP_000068176.1.70763 WP_000068176.1.70790 WP_000068176.1.70791 WP_000068176.1.70807 WP_000068176.1.70808 WP_000068176.1.70818 WP_000068176.1.70823 WP_000068176.1.70829 WP_000068176.1.70835 WP_000068176.1.70843 WP_000068176.1.70850 WP_000068176.1.70855 WP_000068176.1.7089 WP_000068176.1.70909 WP_000068176.1.70917 WP_000068176.1.70924 WP_000068176.1.70926 WP_000068176.1.70930 WP_000068176.1.70939 WP_000068176.1.70943 WP_000068176.1.70994 WP_000068176.1.710 WP_000068176.1.71016 WP_000068176.1.71027 WP_000068176.1.71043 WP_000068176.1.7105 WP_000068176.1.71058 WP_000068176.1.71059 WP_000068176.1.71073 WP_000068176.1.7109 WP_000068176.1.711 WP_000068176.1.71130 WP_000068176.1.71143 WP_000068176.1.71179 WP_000068176.1.71180 WP_000068176.1.71182 WP_000068176.1.7119 WP_000068176.1.71196 WP_000068176.1.7120 WP_000068176.1.71208 WP_000068176.1.71231 WP_000068176.1.71236 WP_000068176.1.7125 WP_000068176.1.71256 WP_000068176.1.71266 WP_000068176.1.71267 WP_000068176.1.71280 WP_000068176.1.71295 WP_000068176.1.71298 WP_000068176.1.71301 WP_000068176.1.71313 WP_000068176.1.71316 WP_000068176.1.71325 WP_000068176.1.71332 WP_000068176.1.71345 WP_000068176.1.71351 WP_000068176.1.71359 WP_000068176.1.71404 WP_000068176.1.71410 WP_000068176.1.71416 WP_000068176.1.71419 WP_000068176.1.71428 WP_000068176.1.71431 WP_000068176.1.71438 WP_000068176.1.71463 WP_000068176.1.71466 WP_000068176.1.71467 WP_000068176.1.71475 WP_000068176.1.71483 WP_000068176.1.71519 WP_000068176.1.71521 WP_000068176.1.71529 WP_000068176.1.71541 WP_000068176.1.71543 WP_000068176.1.71547 WP_000068176.1.71572 WP_000068176.1.71575 WP_000068176.1.7158 WP_000068176.1.71590 WP_000068176.1.71596 WP_000068176.1.71602 WP_000068176.1.7161 WP_000068176.1.7164 WP_000068176.1.71644 WP_000068176.1.71662 WP_000068176.1.71676 WP_000068176.1.71707 WP_000068176.1.71715 WP_000068176.1.71721 WP_000068176.1.71735 WP_000068176.1.71737 WP_000068176.1.71739 WP_000068176.1.71741 WP_000068176.1.71771 WP_000068176.1.71772 WP_000068176.1.71780 WP_000068176.1.71788 WP_000068176.1.7179 WP_000068176.1.71800 WP_000068176.1.71828 WP_000068176.1.71836 WP_000068176.1.71859 WP_000068176.1.71863 WP_000068176.1.71877 WP_000068176.1.71888 WP_000068176.1.71892 WP_000068176.1.71899 WP_000068176.1.71910 WP_000068176.1.71925 WP_000068176.1.7193 WP_000068176.1.71949 WP_000068176.1.71978 WP_000068176.1.7198 WP_000068176.1.71981 WP_000068176.1.71989 WP_000068176.1.72002 WP_000068176.1.72018 WP_000068176.1.72026 WP_000068176.1.72031 WP_000068176.1.72035 WP_000068176.1.72067 WP_000068176.1.72085 WP_000068176.1.72089 WP_000068176.1.72099 WP_000068176.1.72102 WP_000068176.1.72148 WP_000068176.1.72169 WP_000068176.1.72176 WP_000068176.1.722 WP_000068176.1.72204 WP_000068176.1.72205 WP_000068176.1.72224 WP_000068176.1.72257 WP_000068176.1.72271 WP_000068176.1.72285 WP_000068176.1.72306 WP_000068176.1.72315 WP_000068176.1.72330 WP_000068176.1.72340 WP_000068176.1.72347 WP_000068176.1.7236 WP_000068176.1.72363 WP_000068176.1.72366 WP_000068176.1.72371 WP_000068176.1.7242 WP_000068176.1.72424 WP_000068176.1.72433 WP_000068176.1.72446 WP_000068176.1.72453 WP_000068176.1.72465 WP_000068176.1.72478 WP_000068176.1.72489 WP_000068176.1.72496 WP_000068176.1.72497 WP_000068176.1.72529 WP_000068176.1.7254 WP_000068176.1.72547 WP_000068176.1.72564 WP_000068176.1.7258 WP_000068176.1.7260 WP_000068176.1.72626 WP_000068176.1.72649 WP_000068176.1.72654 WP_000068176.1.72666 WP_000068176.1.72708 WP_000068176.1.72719 WP_000068176.1.72753 WP_000068176.1.72760 WP_000068176.1.72762 WP_000068176.1.7278 WP_000068176.1.72787 WP_000068176.1.72816 WP_000068176.1.72832 WP_000068176.1.72834 WP_000068176.1.72835 WP_000068176.1.72874 WP_000068176.1.72881 WP_000068176.1.72903 WP_000068176.1.72904 WP_000068176.1.7292 WP_000068176.1.72930 WP_000068176.1.72935 WP_000068176.1.7294 WP_000068176.1.72945 WP_000068176.1.72961 WP_000068176.1.72965 WP_000068176.1.72991 WP_000068176.1.73002 WP_000068176.1.73004 WP_000068176.1.73017 WP_000068176.1.73021 WP_000068176.1.73022 WP_000068176.1.73037 WP_000068176.1.73046 WP_000068176.1.73074 WP_000068176.1.73087 WP_000068176.1.73121 WP_000068176.1.73122 WP_000068176.1.73132 WP_000068176.1.73140 WP_000068176.1.73190 WP_000068176.1.73191 WP_000068176.1.73195 WP_000068176.1.73201 WP_000068176.1.73211 WP_000068176.1.73240 WP_000068176.1.73241 WP_000068176.1.73246 WP_000068176.1.7326 WP_000068176.1.73264 WP_000068176.1.73265 WP_000068176.1.73286 WP_000068176.1.73312 WP_000068176.1.73386 WP_000068176.1.73401 WP_000068176.1.73402 WP_000068176.1.73420 WP_000068176.1.73444 WP_000068176.1.73450 WP_000068176.1.73456 WP_000068176.1.73464 WP_000068176.1.73467 WP_000068176.1.73489 WP_000068176.1.73501 WP_000068176.1.73513 WP_000068176.1.73526 WP_000068176.1.73536 WP_000068176.1.73547 WP_000068176.1.73571 WP_000068176.1.73591 WP_000068176.1.736 WP_000068176.1.7360 WP_000068176.1.73610 WP_000068176.1.73639 WP_000068176.1.73640 WP_000068176.1.7365 WP_000068176.1.73674 WP_000068176.1.73685 WP_000068176.1.73687 WP_000068176.1.73693 WP_000068176.1.73694 WP_000068176.1.73733 WP_000068176.1.73735 WP_000068176.1.73736 WP_000068176.1.73740 WP_000068176.1.73759 WP_000068176.1.73786 WP_000068176.1.73789 WP_000068176.1.7380 WP_000068176.1.73834 WP_000068176.1.73837 WP_000068176.1.73853 WP_000068176.1.73858 WP_000068176.1.73868 WP_000068176.1.73880 WP_000068176.1.73885 WP_000068176.1.73900 WP_000068176.1.73902 WP_000068176.1.73910 WP_000068176.1.73920 WP_000068176.1.73921 WP_000068176.1.73940 WP_000068176.1.73949 WP_000068176.1.73961 WP_000068176.1.73969 WP_000068176.1.73971 WP_000068176.1.73976 WP_000068176.1.73983 WP_000068176.1.74004 WP_000068176.1.74006 WP_000068176.1.7401 WP_000068176.1.74010 WP_000068176.1.74013 WP_000068176.1.74025 WP_000068176.1.74027 WP_000068176.1.7406 WP_000068176.1.74073 WP_000068176.1.74081 WP_000068176.1.74085 WP_000068176.1.74138 WP_000068176.1.74155 WP_000068176.1.74157 WP_000068176.1.74158 WP_000068176.1.74161 WP_000068176.1.74172 WP_000068176.1.74173 WP_000068176.1.7418 WP_000068176.1.74183 WP_000068176.1.74187 WP_000068176.1.74201 WP_000068176.1.74216 WP_000068176.1.74221 WP_000068176.1.74234 WP_000068176.1.74257 WP_000068176.1.7427 WP_000068176.1.74273 WP_000068176.1.7428 WP_000068176.1.74284 WP_000068176.1.74295 WP_000068176.1.74327 WP_000068176.1.74338 WP_000068176.1.7434 WP_000068176.1.74353 WP_000068176.1.74356 WP_000068176.1.74380 WP_000068176.1.74390 WP_000068176.1.74429 WP_000068176.1.74456 WP_000068176.1.74457 WP_000068176.1.74468 WP_000068176.1.74474 WP_000068176.1.74486 WP_000068176.1.74497 WP_000068176.1.74510 WP_000068176.1.74533 WP_000068176.1.74556 WP_000068176.1.7457 WP_000068176.1.74576 WP_000068176.1.74587 WP_000068176.1.74590 WP_000068176.1.74610 WP_000068176.1.74638 WP_000068176.1.74645 WP_000068176.1.74676 WP_000068176.1.74681 WP_000068176.1.74693 WP_000068176.1.74696 WP_000068176.1.74704 WP_000068176.1.74731 WP_000068176.1.74747 WP_000068176.1.74758 WP_000068176.1.74761 WP_000068176.1.74770 WP_000068176.1.74775 WP_000068176.1.74781 WP_000068176.1.74785 WP_000068176.1.74797 WP_000068176.1.74802 WP_000068176.1.74808 WP_000068176.1.7482 WP_000068176.1.74840 WP_000068176.1.74846 WP_000068176.1.74849 WP_000068176.1.74866 WP_000068176.1.74874 WP_000068176.1.74890 WP_000068176.1.74899 WP_000068176.1.74911 WP_000068176.1.74922 WP_000068176.1.74924 WP_000068176.1.74961 WP_000068176.1.74963 WP_000068176.1.74978 WP_000068176.1.74985 WP_000068176.1.74994 WP_000068176.1.74999 WP_000068176.1.7500 WP_000068176.1.75006 WP_000068176.1.75048 WP_000068176.1.75052 WP_000068176.1.75070 WP_000068176.1.75091 WP_000068176.1.75093 WP_000068176.1.75111 WP_000068176.1.75122 WP_000068176.1.75127 WP_000068176.1.75131 WP_000068176.1.75132 WP_000068176.1.75141 WP_000068176.1.75186 WP_000068176.1.75227 WP_000068176.1.75252 WP_000068176.1.75253 WP_000068176.1.75294 WP_000068176.1.75298 WP_000068176.1.75304 WP_000068176.1.75320 WP_000068176.1.75323 WP_000068176.1.75327 WP_000068176.1.75349 WP_000068176.1.75351 WP_000068176.1.75356 WP_000068176.1.75365 WP_000068176.1.75369 WP_000068176.1.75375 WP_000068176.1.75379 WP_000068176.1.75399 WP_000068176.1.75409 WP_000068176.1.75411 WP_000068176.1.7542 WP_000068176.1.75438 WP_000068176.1.75440 WP_000068176.1.75481 WP_000068176.1.75506 WP_000068176.1.75509 WP_000068176.1.75521 WP_000068176.1.75527 WP_000068176.1.75538 WP_000068176.1.75542 WP_000068176.1.75551 WP_000068176.1.75566 WP_000068176.1.75571 WP_000068176.1.75590 WP_000068176.1.7561 WP_000068176.1.75623 WP_000068176.1.75649 WP_000068176.1.75652 WP_000068176.1.75680 WP_000068176.1.75685 WP_000068176.1.75692 WP_000068176.1.75704 WP_000068176.1.75728 WP_000068176.1.75743 WP_000068176.1.75769 WP_000068176.1.75770 WP_000068176.1.75775 WP_000068176.1.75800 WP_000068176.1.75805 WP_000068176.1.75809 WP_000068176.1.75824 WP_000068176.1.75830 WP_000068176.1.7584 WP_000068176.1.75840 WP_000068176.1.75848 WP_000068176.1.75851 WP_000068176.1.75856 WP_000068176.1.75862 WP_000068176.1.75879 WP_000068176.1.75881 WP_000068176.1.75885 WP_000068176.1.75910 WP_000068176.1.75929 WP_000068176.1.75944 WP_000068176.1.75952 WP_000068176.1.75956 WP_000068176.1.7596 WP_000068176.1.75969 WP_000068176.1.76013 WP_000068176.1.76015 WP_000068176.1.7602 WP_000068176.1.76047 WP_000068176.1.76049 WP_000068176.1.76050 WP_000068176.1.76053 WP_000068176.1.7607 WP_000068176.1.76071 WP_000068176.1.76073 WP_000068176.1.76095 WP_000068176.1.76104 WP_000068176.1.76111 WP_000068176.1.76112 WP_000068176.1.76114 WP_000068176.1.76121 WP_000068176.1.76123 WP_000068176.1.76136 WP_000068176.1.76143 WP_000068176.1.76149 WP_000068176.1.76153 WP_000068176.1.76179 WP_000068176.1.76185 WP_000068176.1.76230 WP_000068176.1.76234 WP_000068176.1.7624 WP_000068176.1.7625 WP_000068176.1.76258 WP_000068176.1.7627 WP_000068176.1.76283 WP_000068176.1.76294 WP_000068176.1.76295 WP_000068176.1.76313 WP_000068176.1.76323 WP_000068176.1.76332 WP_000068176.1.76333 WP_000068176.1.76337 WP_000068176.1.76351 WP_000068176.1.7638 WP_000068176.1.76411 WP_000068176.1.76419 WP_000068176.1.76420 WP_000068176.1.76421 WP_000068176.1.76424 WP_000068176.1.76426 WP_000068176.1.76431 WP_000068176.1.76463 WP_000068176.1.76482 WP_000068176.1.76497 WP_000068176.1.76528 WP_000068176.1.7658 WP_000068176.1.76604 WP_000068176.1.76606 WP_000068176.1.76624 WP_000068176.1.76648 WP_000068176.1.76659 WP_000068176.1.76674 WP_000068176.1.76686 WP_000068176.1.76689 WP_000068176.1.76690 WP_000068176.1.76693 WP_000068176.1.76711 WP_000068176.1.76718 WP_000068176.1.7675 WP_000068176.1.76790 WP_000068176.1.76792 WP_000068176.1.76798 WP_000068176.1.768 WP_000068176.1.76803 WP_000068176.1.76816 WP_000068176.1.76820 WP_000068176.1.76825 WP_000068176.1.76829 WP_000068176.1.76839 WP_000068176.1.76845 WP_000068176.1.7686 WP_000068176.1.76867 WP_000068176.1.76869 WP_000068176.1.76872 WP_000068176.1.76876 WP_000068176.1.76878 WP_000068176.1.76895 WP_000068176.1.76897 WP_000068176.1.76920 WP_000068176.1.76921 WP_000068176.1.76937 WP_000068176.1.7694 WP_000068176.1.76944 WP_000068176.1.76952 WP_000068176.1.76998 WP_000068176.1.77013 WP_000068176.1.77020 WP_000068176.1.77027 WP_000068176.1.77031 WP_000068176.1.77041 WP_000068176.1.77043 WP_000068176.1.77050 WP_000068176.1.77060 WP_000068176.1.77062 WP_000068176.1.77069 WP_000068176.1.77072 WP_000068176.1.77112 WP_000068176.1.77137 WP_000068176.1.77144 WP_000068176.1.77145 WP_000068176.1.77158 WP_000068176.1.77183 WP_000068176.1.77187 WP_000068176.1.77190 WP_000068176.1.77203 WP_000068176.1.77229 WP_000068176.1.77256 WP_000068176.1.77259 WP_000068176.1.77297 WP_000068176.1.77298 WP_000068176.1.77305 WP_000068176.1.77315 WP_000068176.1.77331 WP_000068176.1.77346 WP_000068176.1.77354 WP_000068176.1.77359 WP_000068176.1.77416 WP_000068176.1.77426 WP_000068176.1.77446 WP_000068176.1.7745 WP_000068176.1.7746 WP_000068176.1.77460 WP_000068176.1.77485 WP_000068176.1.77489 WP_000068176.1.77497 WP_000068176.1.77498 WP_000068176.1.7752 WP_000068176.1.77520 WP_000068176.1.77527 WP_000068176.1.77532 WP_000068176.1.77533 WP_000068176.1.77536 WP_000068176.1.77572 WP_000068176.1.77583 WP_000068176.1.77603 WP_000068176.1.77606 WP_000068176.1.77650 WP_000068176.1.77674 WP_000068176.1.77733 WP_000068176.1.77735 WP_000068176.1.77738 WP_000068176.1.7774 WP_000068176.1.77743 WP_000068176.1.77745 WP_000068176.1.77763 WP_000068176.1.77791 WP_000068176.1.77805 WP_000068176.1.77814 WP_000068176.1.77818 WP_000068176.1.77822 WP_000068176.1.77827 WP_000068176.1.77832 WP_000068176.1.77848 WP_000068176.1.7785 WP_000068176.1.77858 WP_000068176.1.7786 WP_000068176.1.77860 WP_000068176.1.7787 WP_000068176.1.77882 WP_000068176.1.77883 WP_000068176.1.77893 WP_000068176.1.77896 WP_000068176.1.77908 WP_000068176.1.77915 WP_000068176.1.77922 WP_000068176.1.77930 WP_000068176.1.77952 WP_000068176.1.77957 WP_000068176.1.77986 WP_000068176.1.78002 WP_000068176.1.78038 WP_000068176.1.78050 WP_000068176.1.78067 WP_000068176.1.78082 WP_000068176.1.78093 WP_000068176.1.7810 WP_000068176.1.78116 WP_000068176.1.78126 WP_000068176.1.78164 WP_000068176.1.78173 WP_000068176.1.78179 WP_000068176.1.78185 WP_000068176.1.78189 WP_000068176.1.78194 WP_000068176.1.78207 WP_000068176.1.78208 WP_000068176.1.78210 WP_000068176.1.78252 WP_000068176.1.78254 WP_000068176.1.78257 WP_000068176.1.7827 WP_000068176.1.78304 WP_000068176.1.78311 WP_000068176.1.78324 WP_000068176.1.7833 WP_000068176.1.78330 WP_000068176.1.78332 WP_000068176.1.78335 WP_000068176.1.78365 WP_000068176.1.78371 WP_000068176.1.78392 WP_000068176.1.78404 WP_000068176.1.78434 WP_000068176.1.78436 WP_000068176.1.78458 WP_000068176.1.78470 WP_000068176.1.78478 WP_000068176.1.78489 WP_000068176.1.78494 WP_000068176.1.7850 WP_000068176.1.78513 WP_000068176.1.7853 WP_000068176.1.78550 WP_000068176.1.78558 WP_000068176.1.7857 WP_000068176.1.78573 WP_000068176.1.78582 WP_000068176.1.78585 WP_000068176.1.78592 WP_000068176.1.78596 WP_000068176.1.78598 WP_000068176.1.78604 WP_000068176.1.78625 WP_000068176.1.78633 WP_000068176.1.78638 WP_000068176.1.78653 WP_000068176.1.78662 WP_000068176.1.78667 WP_000068176.1.7868 WP_000068176.1.78685 WP_000068176.1.78708 WP_000068176.1.78728 WP_000068176.1.78731 WP_000068176.1.78736 WP_000068176.1.78758 WP_000068176.1.78763 WP_000068176.1.78785 WP_000068176.1.78803 WP_000068176.1.78816 WP_000068176.1.78841 WP_000068176.1.78872 WP_000068176.1.7888 WP_000068176.1.78897 WP_000068176.1.78920 WP_000068176.1.78934 WP_000068176.1.78937 WP_000068176.1.78946 WP_000068176.1.78978 WP_000068176.1.78983 WP_000068176.1.78985 WP_000068176.1.78991 WP_000068176.1.78995 WP_000068176.1.7900 WP_000068176.1.79006 WP_000068176.1.79037 WP_000068176.1.79038 WP_000068176.1.7905 WP_000068176.1.79051 WP_000068176.1.79059 WP_000068176.1.79085 WP_000068176.1.79110 WP_000068176.1.79114 WP_000068176.1.79131 WP_000068176.1.79132 WP_000068176.1.7914 WP_000068176.1.79143 WP_000068176.1.79156 WP_000068176.1.79178 WP_000068176.1.79192 WP_000068176.1.79197 WP_000068176.1.79208 WP_000068176.1.79223 WP_000068176.1.79227 WP_000068176.1.79244 WP_000068176.1.79270 WP_000068176.1.79275 WP_000068176.1.79285 WP_000068176.1.7930 WP_000068176.1.7931 WP_000068176.1.79310 WP_000068176.1.79314 WP_000068176.1.79320 WP_000068176.1.79322 WP_000068176.1.79332 WP_000068176.1.79334 WP_000068176.1.7934 WP_000068176.1.79341 WP_000068176.1.79367 WP_000068176.1.79374 WP_000068176.1.79378 WP_000068176.1.79379 WP_000068176.1.79400 WP_000068176.1.79402 WP_000068176.1.79407 WP_000068176.1.79408 WP_000068176.1.79436 WP_000068176.1.79452 WP_000068176.1.79461 WP_000068176.1.79473 WP_000068176.1.79476 WP_000068176.1.79487 WP_000068176.1.79539 WP_000068176.1.79543 WP_000068176.1.79552 WP_000068176.1.79554 WP_000068176.1.79556 WP_000068176.1.79566 WP_000068176.1.79581 WP_000068176.1.79626 WP_000068176.1.79627 WP_000068176.1.79638 WP_000068176.1.79646 WP_000068176.1.79662 WP_000068176.1.79664 WP_000068176.1.79672 WP_000068176.1.79677 WP_000068176.1.79706 WP_000068176.1.79731 WP_000068176.1.79737 WP_000068176.1.79763 WP_000068176.1.7981 WP_000068176.1.79810 WP_000068176.1.79815 WP_000068176.1.79822 WP_000068176.1.79831 WP_000068176.1.79834 WP_000068176.1.79837 WP_000068176.1.79854 WP_000068176.1.79855 WP_000068176.1.7989 WP_000068176.1.79896 WP_000068176.1.79904 WP_000068176.1.79911 WP_000068176.1.79919 WP_000068176.1.7992 WP_000068176.1.79941 WP_000068176.1.79949 WP_000068176.1.79961 WP_000068176.1.79971 WP_000068176.1.79991 WP_000068176.1.80000 WP_000068176.1.80009 WP_000068176.1.80013 WP_000068176.1.80029 WP_000068176.1.80032 WP_000068176.1.80034 WP_000068176.1.80042 WP_000068176.1.80079 WP_000068176.1.80086 WP_000068176.1.80109 WP_000068176.1.80119 WP_000068176.1.80120 WP_000068176.1.80122 WP_000068176.1.80124 WP_000068176.1.80127 WP_000068176.1.80146 WP_000068176.1.80147 WP_000068176.1.80152 WP_000068176.1.80159 WP_000068176.1.80178 WP_000068176.1.80181 WP_000068176.1.80184 WP_000068176.1.80193 WP_000068176.1.80203 WP_000068176.1.80206 WP_000068176.1.80210 WP_000068176.1.80244 WP_000068176.1.80274 WP_000068176.1.80286 WP_000068176.1.80287 WP_000068176.1.80290 WP_000068176.1.80297 WP_000068176.1.8030 WP_000068176.1.80303 WP_000068176.1.80308 WP_000068176.1.8031 WP_000068176.1.80316 WP_000068176.1.80317 WP_000068176.1.80318 WP_000068176.1.80345 WP_000068176.1.80358 WP_000068176.1.80361 WP_000068176.1.80378 WP_000068176.1.80389 WP_000068176.1.80393 WP_000068176.1.8040 WP_000068176.1.80414 WP_000068176.1.8043 WP_000068176.1.80430 WP_000068176.1.80434 WP_000068176.1.8045 WP_000068176.1.80472 WP_000068176.1.80482 WP_000068176.1.80521 WP_000068176.1.80530 WP_000068176.1.80582 WP_000068176.1.80647 WP_000068176.1.80653 WP_000068176.1.8066 WP_000068176.1.80680 WP_000068176.1.80687 WP_000068176.1.80717 WP_000068176.1.80734 WP_000068176.1.80745 WP_000068176.1.80761 WP_000068176.1.80762 WP_000068176.1.80763 WP_000068176.1.8077 WP_000068176.1.80781 WP_000068176.1.80786 WP_000068176.1.80793 WP_000068176.1.80801 WP_000068176.1.80828 WP_000068176.1.80833 WP_000068176.1.8084 WP_000068176.1.80845 WP_000068176.1.8085 WP_000068176.1.80855 WP_000068176.1.80872 WP_000068176.1.80899 WP_000068176.1.80962 WP_000068176.1.80972 WP_000068176.1.80979 WP_000068176.1.80980 WP_000068176.1.81010 WP_000068176.1.81022 WP_000068176.1.81049 WP_000068176.1.81052 WP_000068176.1.81055 WP_000068176.1.81064 WP_000068176.1.81065 WP_000068176.1.81085 WP_000068176.1.81092 WP_000068176.1.81095 WP_000068176.1.81097 WP_000068176.1.81114 WP_000068176.1.81132 WP_000068176.1.81151 WP_000068176.1.81157 WP_000068176.1.81171 WP_000068176.1.81172 WP_000068176.1.81176 WP_000068176.1.81184 WP_000068176.1.81214 WP_000068176.1.81224 WP_000068176.1.81228 WP_000068176.1.81232 WP_000068176.1.81234 WP_000068176.1.81243 WP_000068176.1.8125 WP_000068176.1.81252 WP_000068176.1.81288 WP_000068176.1.81290 WP_000068176.1.81344 WP_000068176.1.8135 WP_000068176.1.81379 WP_000068176.1.81384 WP_000068176.1.81385 WP_000068176.1.81387 WP_000068176.1.81389 WP_000068176.1.8142 WP_000068176.1.81436 WP_000068176.1.8144 WP_000068176.1.81464 WP_000068176.1.81467 WP_000068176.1.81508 WP_000068176.1.81522 WP_000068176.1.81532 WP_000068176.1.81549 WP_000068176.1.81572 WP_000068176.1.81574 WP_000068176.1.81599 WP_000068176.1.8160 WP_000068176.1.81604 WP_000068176.1.81610 WP_000068176.1.81619 WP_000068176.1.81631 WP_000068176.1.81637 WP_000068176.1.81645 WP_000068176.1.81651 WP_000068176.1.81718 WP_000068176.1.81734 WP_000068176.1.81738 WP_000068176.1.81740 WP_000068176.1.81758 WP_000068176.1.8176 WP_000068176.1.81767 WP_000068176.1.81789 WP_000068176.1.8180 WP_000068176.1.81810 WP_000068176.1.81812 WP_000068176.1.81829 WP_000068176.1.81831 WP_000068176.1.81837 WP_000068176.1.81838 WP_000068176.1.81847 WP_000068176.1.8185 WP_000068176.1.81861 WP_000068176.1.81870 WP_000068176.1.8188 WP_000068176.1.81897 WP_000068176.1.81903 WP_000068176.1.81904 WP_000068176.1.81905 WP_000068176.1.81906 WP_000068176.1.81919 WP_000068176.1.81940 WP_000068176.1.81944 WP_000068176.1.81955 WP_000068176.1.81969 WP_000068176.1.81982 WP_000068176.1.81990 WP_000068176.1.81996 WP_000068176.1.81999 WP_000068176.1.82009 WP_000068176.1.82015 WP_000068176.1.82017 WP_000068176.1.82026 WP_000068176.1.82058 WP_000068176.1.8206 WP_000068176.1.82091 WP_000068176.1.82100 WP_000068176.1.82103 WP_000068176.1.8212 WP_000068176.1.82121 WP_000068176.1.8213 WP_000068176.1.82161 WP_000068176.1.82167 WP_000068176.1.82174 WP_000068176.1.82184 WP_000068176.1.82219 WP_000068176.1.82234 WP_000068176.1.82247 WP_000068176.1.82253 WP_000068176.1.82259 WP_000068176.1.82278 WP_000068176.1.82281 WP_000068176.1.82301 WP_000068176.1.82315 WP_000068176.1.82321 WP_000068176.1.82340 WP_000068176.1.82349 WP_000068176.1.82354 WP_000068176.1.82358 WP_000068176.1.82368 WP_000068176.1.82406 WP_000068176.1.8244 WP_000068176.1.82441 WP_000068176.1.82447 WP_000068176.1.82455 WP_000068176.1.82458 WP_000068176.1.8246 WP_000068176.1.82467 WP_000068176.1.82468 WP_000068176.1.82472 WP_000068176.1.82525 WP_000068176.1.82535 WP_000068176.1.82548 WP_000068176.1.82558 WP_000068176.1.8261 WP_000068176.1.82612 WP_000068176.1.8266 WP_000068176.1.82664 WP_000068176.1.82665 WP_000068176.1.82678 WP_000068176.1.82709 WP_000068176.1.82724 WP_000068176.1.82760 WP_000068176.1.82762 WP_000068176.1.82768 WP_000068176.1.82775 WP_000068176.1.82796 WP_000068176.1.8280 WP_000068176.1.82802 WP_000068176.1.82824 WP_000068176.1.82835 WP_000068176.1.82855 WP_000068176.1.82862 WP_000068176.1.8288 WP_000068176.1.8289 WP_000068176.1.82916 WP_000068176.1.82930 WP_000068176.1.82931 WP_000068176.1.82941 WP_000068176.1.82976 WP_000068176.1.82980 WP_000068176.1.82984 WP_000068176.1.82997 WP_000068176.1.82999 WP_000068176.1.83011 WP_000068176.1.83013 WP_000068176.1.8302 WP_000068176.1.83021 WP_000068176.1.83046 WP_000068176.1.83050 WP_000068176.1.83053 WP_000068176.1.83054 WP_000068176.1.83066 WP_000068176.1.83078 WP_000068176.1.83086 WP_000068176.1.83088 WP_000068176.1.8310 WP_000068176.1.83103 WP_000068176.1.83152 WP_000068176.1.83153 WP_000068176.1.8318 WP_000068176.1.83185 WP_000068176.1.8319 WP_000068176.1.83193 WP_000068176.1.83203 WP_000068176.1.83234 WP_000068176.1.83243 WP_000068176.1.83249 WP_000068176.1.83250 WP_000068176.1.83291 WP_000068176.1.83314 WP_000068176.1.83316 WP_000068176.1.83352 WP_000068176.1.83359 WP_000068176.1.83372 WP_000068176.1.83405 WP_000068176.1.83416 WP_000068176.1.83417 WP_000068176.1.83418 WP_000068176.1.8346 WP_000068176.1.83467 WP_000068176.1.83468 WP_000068176.1.83472 WP_000068176.1.83475 WP_000068176.1.83476 WP_000068176.1.83479 WP_000068176.1.83484 WP_000068176.1.83508 WP_000068176.1.83517 WP_000068176.1.83520 WP_000068176.1.83541 WP_000068176.1.83553 WP_000068176.1.83592 WP_000068176.1.83593 WP_000068176.1.83597 WP_000068176.1.83624 WP_000068176.1.83626 WP_000068176.1.83645 WP_000068176.1.83646 WP_000068176.1.83652 WP_000068176.1.83653 WP_000068176.1.8366 WP_000068176.1.83674 WP_000068176.1.83676 WP_000068176.1.83714 WP_000068176.1.83720 WP_000068176.1.83728 WP_000068176.1.83750 WP_000068176.1.83756 WP_000068176.1.83758 WP_000068176.1.83763 WP_000068176.1.83769 WP_000068176.1.83770 WP_000068176.1.83775 WP_000068176.1.83778 WP_000068176.1.83788 WP_000068176.1.83792 WP_000068176.1.83797 WP_000068176.1.83804 WP_000068176.1.83816 WP_000068176.1.83825 WP_000068176.1.8383 WP_000068176.1.83837 WP_000068176.1.83844 WP_000068176.1.8385 WP_000068176.1.83852 WP_000068176.1.83864 WP_000068176.1.83865 WP_000068176.1.83868 WP_000068176.1.83881 WP_000068176.1.83886 WP_000068176.1.83902 WP_000068176.1.83912 WP_000068176.1.83917 WP_000068176.1.83919 WP_000068176.1.83925 WP_000068176.1.83928 WP_000068176.1.83935 WP_000068176.1.83955 WP_000068176.1.83980 WP_000068176.1.83984 WP_000068176.1.83989 WP_000068176.1.84010 WP_000068176.1.84025 WP_000068176.1.84041 WP_000068176.1.84049 WP_000068176.1.84054 WP_000068176.1.84064 WP_000068176.1.84067 WP_000068176.1.84068 WP_000068176.1.84118 WP_000068176.1.84129 WP_000068176.1.84144 WP_000068176.1.84161 WP_000068176.1.84163 WP_000068176.1.84188 WP_000068176.1.84194 WP_000068176.1.84275 WP_000068176.1.84284 WP_000068176.1.8432 WP_000068176.1.84322 WP_000068176.1.84342 WP_000068176.1.84414 WP_000068176.1.84415 WP_000068176.1.84416 WP_000068176.1.84418 WP_000068176.1.84442 WP_000068176.1.84445 WP_000068176.1.84451 WP_000068176.1.84509 WP_000068176.1.84555 WP_000068176.1.84563 WP_000068176.1.84570 WP_000068176.1.84578 WP_000068176.1.84590 WP_000068176.1.84602 WP_000068176.1.84608 WP_000068176.1.84612 WP_000068176.1.8462 WP_000068176.1.84625 WP_000068176.1.84630 WP_000068176.1.84638 WP_000068176.1.84648 WP_000068176.1.84651 WP_000068176.1.84652 WP_000068176.1.84662 WP_000068176.1.84673 WP_000068176.1.84679 WP_000068176.1.8468 WP_000068176.1.84682 WP_000068176.1.84696 WP_000068176.1.84700 WP_000068176.1.84714 WP_000068176.1.84736 WP_000068176.1.8475 WP_000068176.1.84752 WP_000068176.1.84761 WP_000068176.1.84770 WP_000068176.1.84815 WP_000068176.1.84826 WP_000068176.1.84844 WP_000068176.1.84847 WP_000068176.1.84854 WP_000068176.1.84874 WP_000068176.1.84889 WP_000068176.1.84903 WP_000068176.1.84907 WP_000068176.1.84922 WP_000068176.1.84924 WP_000068176.1.8493 WP_000068176.1.84943 WP_000068176.1.84951 WP_000068176.1.8496 WP_000068176.1.84975 WP_000068176.1.84978 WP_000068176.1.85017 WP_000068176.1.85022 WP_000068176.1.85026 WP_000068176.1.85045 WP_000068176.1.85047 WP_000068176.1.85056 WP_000068176.1.85070 WP_000068176.1.85081 WP_000068176.1.85083 WP_000068176.1.85099 WP_000068176.1.851 WP_000068176.1.85113 WP_000068176.1.85118 WP_000068176.1.85132 WP_000068176.1.85133 WP_000068176.1.85135 WP_000068176.1.85144 WP_000068176.1.85151 WP_000068176.1.85160 WP_000068176.1.85173 WP_000068176.1.85198 WP_000068176.1.85213 WP_000068176.1.85224 WP_000068176.1.85226 WP_000068176.1.85229 WP_000068176.1.85231 WP_000068176.1.85235 WP_000068176.1.85238 WP_000068176.1.85265 WP_000068176.1.85289 WP_000068176.1.85292 WP_000068176.1.85294 WP_000068176.1.85297 WP_000068176.1.85331 WP_000068176.1.85351 WP_000068176.1.85354 WP_000068176.1.85374 WP_000068176.1.85375 WP_000068176.1.85376 WP_000068176.1.85383 WP_000068176.1.85391 WP_000068176.1.85395 WP_000068176.1.85401 WP_000068176.1.85409 WP_000068176.1.85425 WP_000068176.1.85440 WP_000068176.1.85441 WP_000068176.1.85445 WP_000068176.1.85455 WP_000068176.1.85462 WP_000068176.1.85471 WP_000068176.1.85474 WP_000068176.1.85485 WP_000068176.1.85492 WP_000068176.1.8551 WP_000068176.1.85515 WP_000068176.1.85542 WP_000068176.1.85547 WP_000068176.1.85549 WP_000068176.1.85555 WP_000068176.1.85562 WP_000068176.1.85585 WP_000068176.1.85586 WP_000068176.1.85596 WP_000068176.1.85607 WP_000068176.1.85611 WP_000068176.1.85634 WP_000068176.1.85649 WP_000068176.1.85678 WP_000068176.1.85705 WP_000068176.1.8572 WP_000068176.1.85730 WP_000068176.1.85732 WP_000068176.1.85758 WP_000068176.1.8576 WP_000068176.1.85795 WP_000068176.1.85796 WP_000068176.1.85809 WP_000068176.1.85816 WP_000068176.1.85825 WP_000068176.1.85834 WP_000068176.1.85844 WP_000068176.1.85858 WP_000068176.1.85873 WP_000068176.1.85906 WP_000068176.1.85924 WP_000068176.1.85927 WP_000068176.1.85950 WP_000068176.1.85971 WP_000068176.1.85980 WP_000068176.1.85989 WP_000068176.1.85993 WP_000068176.1.86018 WP_000068176.1.86036 WP_000068176.1.86042 WP_000068176.1.86072 WP_000068176.1.86086 WP_000068176.1.8609 WP_000068176.1.86101 WP_000068176.1.86106 WP_000068176.1.86123 WP_000068176.1.86136 WP_000068176.1.86144 WP_000068176.1.86153 WP_000068176.1.86154 WP_000068176.1.86158 WP_000068176.1.8617 WP_000068176.1.86178 WP_000068176.1.86188 WP_000068176.1.86197 WP_000068176.1.862 WP_000068176.1.86207 WP_000068176.1.86209 WP_000068176.1.86241 WP_000068176.1.86248 WP_000068176.1.86256 WP_000068176.1.8627 WP_000068176.1.86270 WP_000068176.1.86281 WP_000068176.1.86304 WP_000068176.1.86315 WP_000068176.1.86331 WP_000068176.1.86344 WP_000068176.1.8636 WP_000068176.1.86363 WP_000068176.1.86367 WP_000068176.1.86378 WP_000068176.1.86390 WP_000068176.1.8641 WP_000068176.1.8643 WP_000068176.1.86439 WP_000068176.1.86455 WP_000068176.1.86473 WP_000068176.1.86482 WP_000068176.1.86505 WP_000068176.1.86508 WP_000068176.1.86523 WP_000068176.1.86526 WP_000068176.1.86531 WP_000068176.1.86542 WP_000068176.1.86606 WP_000068176.1.86628 WP_000068176.1.86629 WP_000068176.1.8663 WP_000068176.1.86664 WP_000068176.1.86704 WP_000068176.1.86706 WP_000068176.1.86736 WP_000068176.1.86745 WP_000068176.1.86754 WP_000068176.1.86779 WP_000068176.1.86792 WP_000068176.1.86793 WP_000068176.1.86795 WP_000068176.1.8681 WP_000068176.1.86838 WP_000068176.1.86881 WP_000068176.1.8690 WP_000068176.1.86910 WP_000068176.1.86911 WP_000068176.1.86916 WP_000068176.1.86940 WP_000068176.1.86942 WP_000068176.1.86955 WP_000068176.1.86961 WP_000068176.1.86968 WP_000068176.1.86977 WP_000068176.1.8699 WP_000068176.1.86999 WP_000068176.1.87021 WP_000068176.1.87022 WP_000068176.1.87042 WP_000068176.1.87057 WP_000068176.1.87072 WP_000068176.1.87088 WP_000068176.1.87090 WP_000068176.1.87096 WP_000068176.1.87097 WP_000068176.1.87100 WP_000068176.1.87110 WP_000068176.1.87119 WP_000068176.1.8712 WP_000068176.1.87122 WP_000068176.1.87133 WP_000068176.1.87137 WP_000068176.1.87168 WP_000068176.1.87175 WP_000068176.1.87190 WP_000068176.1.87194 WP_000068176.1.8720 WP_000068176.1.87204 WP_000068176.1.87221 WP_000068176.1.87236 WP_000068176.1.87250 WP_000068176.1.87260 WP_000068176.1.87261 WP_000068176.1.87263 WP_000068176.1.87272 WP_000068176.1.87285 WP_000068176.1.87290 WP_000068176.1.87296 WP_000068176.1.8731 WP_000068176.1.87363 WP_000068176.1.87372 WP_000068176.1.87378 WP_000068176.1.87388 WP_000068176.1.87391 WP_000068176.1.87396 WP_000068176.1.87397 WP_000068176.1.87425 WP_000068176.1.87434 WP_000068176.1.87457 WP_000068176.1.87461 WP_000068176.1.87466 WP_000068176.1.87475 WP_000068176.1.87486 WP_000068176.1.87497 WP_000068176.1.87498 WP_000068176.1.875 WP_000068176.1.87502 WP_000068176.1.87508 WP_000068176.1.87511 WP_000068176.1.87515 WP_000068176.1.8753 WP_000068176.1.87534 WP_000068176.1.87543 WP_000068176.1.8757 WP_000068176.1.87579 WP_000068176.1.87593 WP_000068176.1.87595 WP_000068176.1.87601 WP_000068176.1.87623 WP_000068176.1.87636 WP_000068176.1.8764 WP_000068176.1.87647 WP_000068176.1.87682 WP_000068176.1.8770 WP_000068176.1.87703 WP_000068176.1.87710 WP_000068176.1.87718 WP_000068176.1.87734 WP_000068176.1.87735 WP_000068176.1.87740 WP_000068176.1.87745 WP_000068176.1.87748 WP_000068176.1.87764 WP_000068176.1.87782 WP_000068176.1.8779 WP_000068176.1.87802 WP_000068176.1.87808 WP_000068176.1.87828 WP_000068176.1.87838 WP_000068176.1.87841 WP_000068176.1.87843 WP_000068176.1.87854 WP_000068176.1.87865 WP_000068176.1.87879 WP_000068176.1.8791 WP_000068176.1.87912 WP_000068176.1.87937 WP_000068176.1.87943 WP_000068176.1.87948 WP_000068176.1.87963 WP_000068176.1.87964 WP_000068176.1.87967 WP_000068176.1.87972 WP_000068176.1.87985 WP_000068176.1.87995 WP_000068176.1.88013 WP_000068176.1.88032 WP_000068176.1.88061 WP_000068176.1.88101 WP_000068176.1.88114 WP_000068176.1.88150 WP_000068176.1.88166 WP_000068176.1.88169 WP_000068176.1.8820 WP_000068176.1.88212 WP_000068176.1.88240 WP_000068176.1.88270 WP_000068176.1.88279 WP_000068176.1.88309 WP_000068176.1.88311 WP_000068176.1.88319 WP_000068176.1.88328 WP_000068176.1.88339 WP_000068176.1.88348 WP_000068176.1.88351 WP_000068176.1.88367 WP_000068176.1.88371 WP_000068176.1.88375 WP_000068176.1.88380 WP_000068176.1.88395 WP_000068176.1.88418 WP_000068176.1.88430 WP_000068176.1.88440 WP_000068176.1.88445 WP_000068176.1.88449 WP_000068176.1.88455 WP_000068176.1.8847 WP_000068176.1.88471 WP_000068176.1.88473 WP_000068176.1.88478 WP_000068176.1.88480 WP_000068176.1.88490 WP_000068176.1.88498 WP_000068176.1.88504 WP_000068176.1.88518 WP_000068176.1.88536 WP_000068176.1.88555 WP_000068176.1.88558 WP_000068176.1.88560 WP_000068176.1.88563 WP_000068176.1.8857 WP_000068176.1.88572 WP_000068176.1.88580 WP_000068176.1.88583 WP_000068176.1.88585 WP_000068176.1.8859 WP_000068176.1.88599 WP_000068176.1.88600 WP_000068176.1.88614 WP_000068176.1.88623 WP_000068176.1.88636 WP_000068176.1.88638 WP_000068176.1.88642 WP_000068176.1.88671 WP_000068176.1.88696 WP_000068176.1.8872 WP_000068176.1.88738 WP_000068176.1.88739 WP_000068176.1.88753 WP_000068176.1.88761 WP_000068176.1.8877 WP_000068176.1.88771 WP_000068176.1.88781 WP_000068176.1.88805 WP_000068176.1.88827 WP_000068176.1.88843 WP_000068176.1.88856 WP_000068176.1.88859 WP_000068176.1.8886 WP_000068176.1.88861 WP_000068176.1.88871 WP_000068176.1.88874 WP_000068176.1.88878 WP_000068176.1.8888 WP_000068176.1.88881 WP_000068176.1.88897 WP_000068176.1.88912 WP_000068176.1.88922 WP_000068176.1.88934 WP_000068176.1.88954 WP_000068176.1.88959 WP_000068176.1.88960 WP_000068176.1.88962 WP_000068176.1.88987 WP_000068176.1.8899 WP_000068176.1.8900 WP_000068176.1.89012 WP_000068176.1.89024 WP_000068176.1.89027 WP_000068176.1.89036 WP_000068176.1.8904 WP_000068176.1.89070 WP_000068176.1.89086 WP_000068176.1.89103 WP_000068176.1.89108 WP_000068176.1.89125 WP_000068176.1.8913 WP_000068176.1.89133 WP_000068176.1.89139 WP_000068176.1.89173 WP_000068176.1.8918 WP_000068176.1.89181 WP_000068176.1.89184 WP_000068176.1.89194 WP_000068176.1.89195 WP_000068176.1.89204 WP_000068176.1.89216 WP_000068176.1.89229 WP_000068176.1.89235 WP_000068176.1.89237 WP_000068176.1.8924 WP_000068176.1.89258 WP_000068176.1.89262 WP_000068176.1.89284 WP_000068176.1.8929 WP_000068176.1.89290 WP_000068176.1.89347 WP_000068176.1.89348 WP_000068176.1.89350 WP_000068176.1.89372 WP_000068176.1.89390 WP_000068176.1.89404 WP_000068176.1.89414 WP_000068176.1.89433 WP_000068176.1.89439 WP_000068176.1.89476 WP_000068176.1.8950 WP_000068176.1.89516 WP_000068176.1.8953 WP_000068176.1.89537 WP_000068176.1.89544 WP_000068176.1.89545 WP_000068176.1.89556 WP_000068176.1.89557 WP_000068176.1.89559 WP_000068176.1.89594 WP_000068176.1.89603 WP_000068176.1.89628 WP_000068176.1.89651 WP_000068176.1.89655 WP_000068176.1.89672 WP_000068176.1.89678 WP_000068176.1.89686 WP_000068176.1.897 WP_000068176.1.89715 WP_000068176.1.89726 WP_000068176.1.89730 WP_000068176.1.89754 WP_000068176.1.89779 WP_000068176.1.89794 WP_000068176.1.89799 WP_000068176.1.898 WP_000068176.1.89857 WP_000068176.1.8986 WP_000068176.1.89860 WP_000068176.1.89863 WP_000068176.1.89874 WP_000068176.1.89883 WP_000068176.1.89908 WP_000068176.1.89924 WP_000068176.1.89933 WP_000068176.1.89949 WP_000068176.1.89950 WP_000068176.1.89960 WP_000068176.1.90005 WP_000068176.1.90018 WP_000068176.1.90038 WP_000068176.1.90046 WP_000068176.1.90055 WP_000068176.1.90069 WP_000068176.1.90091 WP_000068176.1.90095 WP_000068176.1.90112 WP_000068176.1.90131 WP_000068176.1.90145 WP_000068176.1.90148 WP_000068176.1.90161 WP_000068176.1.90173 WP_000068176.1.90174 WP_000068176.1.90180 WP_000068176.1.90215 WP_000068176.1.90217 WP_000068176.1.9022 WP_000068176.1.90232 WP_000068176.1.90239 WP_000068176.1.90243 WP_000068176.1.90244 WP_000068176.1.90246 WP_000068176.1.90250 WP_000068176.1.90253 WP_000068176.1.90269 WP_000068176.1.90276 WP_000068176.1.9030 WP_000068176.1.90307 WP_000068176.1.90331 WP_000068176.1.90345 WP_000068176.1.90367 WP_000068176.1.90370 WP_000068176.1.90386 WP_000068176.1.90432 WP_000068176.1.90447 WP_000068176.1.90454 WP_000068176.1.90473 WP_000068176.1.90475 WP_000068176.1.90488 WP_000068176.1.90506 WP_000068176.1.90514 WP_000068176.1.90517 WP_000068176.1.90533 WP_000068176.1.90544 WP_000068176.1.90548 WP_000068176.1.9055 WP_000068176.1.90554 WP_000068176.1.90556 WP_000068176.1.90562 WP_000068176.1.90604 WP_000068176.1.90647 WP_000068176.1.90660 WP_000068176.1.90661 WP_000068176.1.90683 WP_000068176.1.90698 WP_000068176.1.9071 WP_000068176.1.90717 WP_000068176.1.90726 WP_000068176.1.90728 WP_000068176.1.90738 WP_000068176.1.9074 WP_000068176.1.90740 WP_000068176.1.90745 WP_000068176.1.90757 WP_000068176.1.9076 WP_000068176.1.90777 WP_000068176.1.90801 WP_000068176.1.90804 WP_000068176.1.90818 WP_000068176.1.90820 WP_000068176.1.90861 WP_000068176.1.90875 WP_000068176.1.90887 WP_000068176.1.90896 WP_000068176.1.90903 WP_000068176.1.90923 WP_000068176.1.90928 WP_000068176.1.90994 WP_000068176.1.9100 WP_000068176.1.91005 WP_000068176.1.91011 WP_000068176.1.91019 WP_000068176.1.91087 WP_000068176.1.91089 WP_000068176.1.91124 WP_000068176.1.91126 WP_000068176.1.9114 WP_000068176.1.91150 WP_000068176.1.91158 WP_000068176.1.91184 WP_000068176.1.912 WP_000068176.1.9122 WP_000068176.1.91233 WP_000068176.1.91246 WP_000068176.1.91252 WP_000068176.1.91258 WP_000068176.1.9127 WP_000068176.1.91279 WP_000068176.1.91280 WP_000068176.1.91287 WP_000068176.1.91297 WP_000068176.1.9130 WP_000068176.1.91310 WP_000068176.1.91316 WP_000068176.1.91332 WP_000068176.1.91346 WP_000068176.1.91357 WP_000068176.1.91364 WP_000068176.1.91365 WP_000068176.1.91371 WP_000068176.1.91380 WP_000068176.1.91382 WP_000068176.1.9140 WP_000068176.1.91420 WP_000068176.1.91427 WP_000068176.1.91447 WP_000068176.1.91465 WP_000068176.1.91486 WP_000068176.1.91487 WP_000068176.1.91500 WP_000068176.1.91501 WP_000068176.1.91525 WP_000068176.1.9153 WP_000068176.1.91530 WP_000068176.1.91542 WP_000068176.1.91547 WP_000068176.1.9155 WP_000068176.1.91559 WP_000068176.1.91573 WP_000068176.1.91581 WP_000068176.1.91586 WP_000068176.1.91587 WP_000068176.1.91591 WP_000068176.1.91611 WP_000068176.1.91624 WP_000068176.1.91629 WP_000068176.1.91634 WP_000068176.1.91635 WP_000068176.1.91639 WP_000068176.1.91660 WP_000068176.1.91670 WP_000068176.1.917 WP_000068176.1.91704 WP_000068176.1.91745 WP_000068176.1.91746 WP_000068176.1.91771 WP_000068176.1.91781 WP_000068176.1.91791 WP_000068176.1.91800 WP_000068176.1.91816 WP_000068176.1.91829 WP_000068176.1.91848 WP_000068176.1.91895 WP_000068176.1.91909 WP_000068176.1.91911 WP_000068176.1.91918 WP_000068176.1.91919 WP_000068176.1.91928 WP_000068176.1.91950 WP_000068176.1.91955 WP_000068176.1.91969 WP_000068176.1.92 WP_000068176.1.92055 WP_000068176.1.92057 WP_000068176.1.92080 WP_000068176.1.92104 WP_000068176.1.92110 WP_000068176.1.92115 WP_000068176.1.92125 WP_000068176.1.92133 WP_000068176.1.92140 WP_000068176.1.92143 WP_000068176.1.92147 WP_000068176.1.92158 WP_000068176.1.92164 WP_000068176.1.92169 WP_000068176.1.92185 WP_000068176.1.92186 WP_000068176.1.92196 WP_000068176.1.92212 WP_000068176.1.92218 WP_000068176.1.92227 WP_000068176.1.9224 WP_000068176.1.92244 WP_000068176.1.92249 WP_000068176.1.92253 WP_000068176.1.92254 WP_000068176.1.92259 WP_000068176.1.92278 WP_000068176.1.92297 WP_000068176.1.923 WP_000068176.1.92303 WP_000068176.1.92324 WP_000068176.1.9234 WP_000068176.1.92340 WP_000068176.1.9237 WP_000068176.1.92391 WP_000068176.1.92398 WP_000068176.1.92405 WP_000068176.1.92415 WP_000068176.1.92424 WP_000068176.1.92425 WP_000068176.1.92436 WP_000068176.1.92442 WP_000068176.1.9247 WP_000068176.1.92479 WP_000068176.1.92488 WP_000068176.1.92497 WP_000068176.1.92500 WP_000068176.1.92512 WP_000068176.1.92520 WP_000068176.1.92534 WP_000068176.1.92541 WP_000068176.1.92544 WP_000068176.1.92546 WP_000068176.1.92560 WP_000068176.1.92602 WP_000068176.1.92607 WP_000068176.1.92667 WP_000068176.1.92674 WP_000068176.1.92679 WP_000068176.1.92688 WP_000068176.1.92691 WP_000068176.1.92718 WP_000068176.1.92723 WP_000068176.1.92726 WP_000068176.1.92735 WP_000068176.1.92741 WP_000068176.1.92765 WP_000068176.1.92772 WP_000068176.1.92773 WP_000068176.1.92789 WP_000068176.1.92795 WP_000068176.1.92805 WP_000068176.1.92840 WP_000068176.1.92848 WP_000068176.1.92849 WP_000068176.1.9286 WP_000068176.1.92862 WP_000068176.1.92864 WP_000068176.1.92897 WP_000068176.1.92918 WP_000068176.1.9293 WP_000068176.1.92937 WP_000068176.1.92950 WP_000068176.1.9296 WP_000068176.1.92960 WP_000068176.1.92965 WP_000068176.1.9298 WP_000068176.1.92997 WP_000068176.1.93010 WP_000068176.1.93041 WP_000068176.1.93047 WP_000068176.1.9305 WP_000068176.1.93068 WP_000068176.1.93071 WP_000068176.1.93074 WP_000068176.1.93078 WP_000068176.1.93125 WP_000068176.1.93147 WP_000068176.1.93163 WP_000068176.1.93176 WP_000068176.1.93186 WP_000068176.1.93191 WP_000068176.1.93197 WP_000068176.1.93198 WP_000068176.1.93207 WP_000068176.1.93211 WP_000068176.1.93224 WP_000068176.1.93231 WP_000068176.1.93235 WP_000068176.1.93237 WP_000068176.1.93243 WP_000068176.1.93251 WP_000068176.1.93254 WP_000068176.1.93260 WP_000068176.1.93263 WP_000068176.1.93296 WP_000068176.1.9330 WP_000068176.1.93300 WP_000068176.1.93316 WP_000068176.1.93329 WP_000068176.1.93336 WP_000068176.1.93354 WP_000068176.1.93374 WP_000068176.1.93378 WP_000068176.1.93416 WP_000068176.1.93435 WP_000068176.1.93438 WP_000068176.1.93444 WP_000068176.1.9346 WP_000068176.1.93471 WP_000068176.1.93492 WP_000068176.1.93514 WP_000068176.1.9352 WP_000068176.1.9354 WP_000068176.1.93561 WP_000068176.1.93567 WP_000068176.1.93579 WP_000068176.1.9358 WP_000068176.1.93590 WP_000068176.1.93613 WP_000068176.1.93647 WP_000068176.1.93658 WP_000068176.1.93669 WP_000068176.1.93678 WP_000068176.1.93690 WP_000068176.1.93708 WP_000068176.1.93710 WP_000068176.1.93722 WP_000068176.1.93736 WP_000068176.1.93738 WP_000068176.1.93758 WP_000068176.1.93762 WP_000068176.1.93769 WP_000068176.1.93775 WP_000068176.1.93787 WP_000068176.1.93862 WP_000068176.1.9387 WP_000068176.1.93882 WP_000068176.1.93883 WP_000068176.1.93890 WP_000068176.1.93891 WP_000068176.1.9392 WP_000068176.1.93934 WP_000068176.1.93972 WP_000068176.1.93975 WP_000068176.1.93976 WP_000068176.1.9398 WP_000068176.1.93981 WP_000068176.1.94 WP_000068176.1.94009 WP_000068176.1.94016 WP_000068176.1.94053 WP_000068176.1.94060 WP_000068176.1.94074 WP_000068176.1.9408 WP_000068176.1.94080 WP_000068176.1.94082 WP_000068176.1.94087 WP_000068176.1.94093 WP_000068176.1.94096 WP_000068176.1.94114 WP_000068176.1.94119 WP_000068176.1.94122 WP_000068176.1.94123 WP_000068176.1.94130 WP_000068176.1.94165 WP_000068176.1.94172 WP_000068176.1.94182 WP_000068176.1.94209 WP_000068176.1.94229 WP_000068176.1.94242 WP_000068176.1.94245 WP_000068176.1.94248 WP_000068176.1.94268 WP_000068176.1.94287 WP_000068176.1.94293 WP_000068176.1.94294 WP_000068176.1.9430 WP_000068176.1.94319 WP_000068176.1.94324 WP_000068176.1.94325 WP_000068176.1.94335 WP_000068176.1.94337 WP_000068176.1.94340 WP_000068176.1.94341 WP_000068176.1.94345 WP_000068176.1.9435 WP_000068176.1.9437 WP_000068176.1.94374 WP_000068176.1.94375 WP_000068176.1.94376 WP_000068176.1.94389 WP_000068176.1.94407 WP_000068176.1.94409 WP_000068176.1.94414 WP_000068176.1.94423 WP_000068176.1.94484 WP_000068176.1.94505 WP_000068176.1.94530 WP_000068176.1.94536 WP_000068176.1.94549 WP_000068176.1.9455 WP_000068176.1.94550 WP_000068176.1.94576 WP_000068176.1.94625 WP_000068176.1.94636 WP_000068176.1.9464 WP_000068176.1.94641 WP_000068176.1.94684 WP_000068176.1.94688 WP_000068176.1.947 WP_000068176.1.94719 WP_000068176.1.94733 WP_000068176.1.94741 WP_000068176.1.94789 WP_000068176.1.94825 WP_000068176.1.94838 WP_000068176.1.94844 WP_000068176.1.94845 WP_000068176.1.9485 WP_000068176.1.94857 WP_000068176.1.94866 WP_000068176.1.94941 WP_000068176.1.9495 WP_000068176.1.94958 WP_000068176.1.94969 WP_000068176.1.9497 WP_000068176.1.94992 WP_000068176.1.94999 WP_000068176.1.95002 WP_000068176.1.95008 WP_000068176.1.95014 WP_000068176.1.95023 WP_000068176.1.95029 WP_000068176.1.95033 WP_000068176.1.95038 WP_000068176.1.95049 WP_000068176.1.95075 WP_000068176.1.95077 WP_000068176.1.95090 WP_000068176.1.9510 WP_000068176.1.95120 WP_000068176.1.95154 WP_000068176.1.95156 WP_000068176.1.95174 WP_000068176.1.95193 WP_000068176.1.95210 WP_000068176.1.95263 WP_000068176.1.95294 WP_000068176.1.95304 WP_000068176.1.95307 WP_000068176.1.95318 WP_000068176.1.95327 WP_000068176.1.95342 WP_000068176.1.95361 WP_000068176.1.95372 WP_000068176.1.9538 WP_000068176.1.95386 WP_000068176.1.95409 WP_000068176.1.95415 WP_000068176.1.9544 WP_000068176.1.95442 WP_000068176.1.95452 WP_000068176.1.95476 WP_000068176.1.95494 WP_000068176.1.95495 WP_000068176.1.95500 WP_000068176.1.95505 WP_000068176.1.95512 WP_000068176.1.95519 WP_000068176.1.95522 WP_000068176.1.95535 WP_000068176.1.95537 WP_000068176.1.95545 WP_000068176.1.95550 WP_000068176.1.95552 WP_000068176.1.95560 WP_000068176.1.9557 WP_000068176.1.95571 WP_000068176.1.95581 WP_000068176.1.95603 WP_000068176.1.9563 WP_000068176.1.95631 WP_000068176.1.95639 WP_000068176.1.95640 WP_000068176.1.95681 WP_000068176.1.95683 WP_000068176.1.95699 WP_000068176.1.95704 WP_000068176.1.95713 WP_000068176.1.95714 WP_000068176.1.95737 WP_000068176.1.95760 WP_000068176.1.95780 WP_000068176.1.95781 WP_000068176.1.95804 WP_000068176.1.95806 WP_000068176.1.95832 WP_000068176.1.95877 WP_000068176.1.95885 WP_000068176.1.959 WP_000068176.1.95914 WP_000068176.1.95918 WP_000068176.1.95947 WP_000068176.1.95962 WP_000068176.1.95983 WP_000068176.1.95986 WP_000068176.1.95997 WP_000068176.1.96014 WP_000068176.1.96022 WP_000068176.1.96030 WP_000068176.1.96056 WP_000068176.1.96057 WP_000068176.1.96067 WP_000068176.1.96075 WP_000068176.1.96105 WP_000068176.1.96133 WP_000068176.1.96135 WP_000068176.1.96148 WP_000068176.1.96160 WP_000068176.1.96163 WP_000068176.1.96165 WP_000068176.1.9617 WP_000068176.1.96200 WP_000068176.1.96209 WP_000068176.1.96218 WP_000068176.1.96221 WP_000068176.1.96228 WP_000068176.1.96255 WP_000068176.1.96261 WP_000068176.1.96271 WP_000068176.1.96280 WP_000068176.1.96283 WP_000068176.1.96297 WP_000068176.1.96301 WP_000068176.1.96305 WP_000068176.1.96312 WP_000068176.1.96314 WP_000068176.1.96316 WP_000068176.1.96322 WP_000068176.1.96334 WP_000068176.1.96362 WP_000068176.1.96364 WP_000068176.1.96368 WP_000068176.1.96424 WP_000068176.1.96433 WP_000068176.1.96468 WP_000068176.1.96472 WP_000068176.1.96474 WP_000068176.1.96477 WP_000068176.1.96489 WP_000068176.1.96495 WP_000068176.1.9650 WP_000068176.1.96509 WP_000068176.1.96535 WP_000068176.1.96538 WP_000068176.1.96548 WP_000068176.1.96550 WP_000068176.1.96554 WP_000068176.1.96566 WP_000068176.1.96568 WP_000068176.1.96577 WP_000068176.1.96578 WP_000068176.1.96591 WP_000068176.1.96603 WP_000068176.1.96613 WP_000068176.1.96628 WP_000068176.1.96634 WP_000068176.1.96637 WP_000068176.1.96638 WP_000068176.1.96646 WP_000068176.1.96654 WP_000068176.1.96663 WP_000068176.1.96678 WP_000068176.1.96682 WP_000068176.1.96688 WP_000068176.1.96699 WP_000068176.1.96705 WP_000068176.1.96718 WP_000068176.1.96727 WP_000068176.1.9675 WP_000068176.1.96770 WP_000068176.1.96780 WP_000068176.1.96804 WP_000068176.1.96836 WP_000068176.1.9684 WP_000068176.1.96854 WP_000068176.1.96855 WP_000068176.1.96856 WP_000068176.1.96859 WP_000068176.1.96866 WP_000068176.1.96882 WP_000068176.1.96892 WP_000068176.1.96895 WP_000068176.1.96918 WP_000068176.1.96922 WP_000068176.1.96928 WP_000068176.1.9695 WP_000068176.1.96956 WP_000068176.1.96965 WP_000068176.1.96969 WP_000068176.1.96970 WP_000068176.1.96976 WP_000068176.1.96985 WP_000068176.1.96997 WP_000068176.1.97000 WP_000068176.1.97001 WP_000068176.1.97004 WP_000068176.1.97007 WP_000068176.1.97014 WP_000068176.1.97017 WP_000068176.1.97019 WP_000068176.1.97033 WP_000068176.1.97034 WP_000068176.1.97072 WP_000068176.1.97077 WP_000068176.1.97117 WP_000068176.1.97138 WP_000068176.1.97139 WP_000068176.1.97141 WP_000068176.1.97146 WP_000068176.1.97151 WP_000068176.1.97161 WP_000068176.1.97164 WP_000068176.1.97191 WP_000068176.1.97205 WP_000068176.1.97206 WP_000068176.1.97228 WP_000068176.1.97230 WP_000068176.1.97234 WP_000068176.1.97241 WP_000068176.1.97256 WP_000068176.1.97267 WP_000068176.1.97276 WP_000068176.1.97293 WP_000068176.1.97295 WP_000068176.1.97302 WP_000068176.1.97311 WP_000068176.1.97312 WP_000068176.1.97336 WP_000068176.1.97348 WP_000068176.1.97367 WP_000068176.1.9737 WP_000068176.1.97392 WP_000068176.1.97399 WP_000068176.1.97409 WP_000068176.1.97411 WP_000068176.1.9743 WP_000068176.1.97444 WP_000068176.1.97450 WP_000068176.1.97456 WP_000068176.1.97460 WP_000068176.1.97466 WP_000068176.1.97468 WP_000068176.1.9748 WP_000068176.1.97484 WP_000068176.1.97494 WP_000068176.1.97530 WP_000068176.1.97531 WP_000068176.1.97536 WP_000068176.1.97537 WP_000068176.1.97574 WP_000068176.1.97575 WP_000068176.1.97576 WP_000068176.1.9758 WP_000068176.1.97585 WP_000068176.1.97590 WP_000068176.1.97627 WP_000068176.1.97641 WP_000068176.1.97664 WP_000068176.1.97687 WP_000068176.1.97688 WP_000068176.1.97696 WP_000068176.1.97699 WP_000068176.1.97706 WP_000068176.1.97717 WP_000068176.1.97720 WP_000068176.1.97729 WP_000068176.1.97731 WP_000068176.1.97739 WP_000068176.1.97742 WP_000068176.1.97744 WP_000068176.1.97746 WP_000068176.1.97758 WP_000068176.1.97762 WP_000068176.1.97763 WP_000068176.1.97776 WP_000068176.1.97786 WP_000068176.1.97827 WP_000068176.1.97835 WP_000068176.1.9788 WP_000068176.1.9789 WP_000068176.1.97898 WP_000068176.1.97899 WP_000068176.1.97928 WP_000068176.1.97935 WP_000068176.1.97953 WP_000068176.1.97955 WP_000068176.1.97967 WP_000068176.1.97974 WP_000068176.1.97997 WP_000068176.1.97999 WP_000068176.1.98008 WP_000068176.1.98011 WP_000068176.1.98033 WP_000068176.1.98051 WP_000068176.1.98058 WP_000068176.1.98073 WP_000068176.1.98077 WP_000068176.1.98131 WP_000068176.1.98161 WP_000068176.1.98174 WP_000068176.1.98179 WP_000068176.1.98191 WP_000068176.1.98195 WP_000068176.1.98233 WP_000068176.1.98242 WP_000068176.1.98248 WP_000068176.1.98249 WP_000068176.1.98281 WP_000068176.1.98295 WP_000068176.1.98307 WP_000068176.1.98322 WP_000068176.1.98328 WP_000068176.1.98352 WP_000068176.1.98353 WP_000068176.1.98359 WP_000068176.1.98360 WP_000068176.1.98361 WP_000068176.1.98372 WP_000068176.1.98379 WP_000068176.1.98387 WP_000068176.1.98394 WP_000068176.1.98409 WP_000068176.1.98411 WP_000068176.1.98415 WP_000068176.1.98419 WP_000068176.1.98425 WP_000068176.1.98456 WP_000068176.1.98497 WP_000068176.1.98501 WP_000068176.1.98506 WP_000068176.1.98510 WP_000068176.1.98512 WP_000068176.1.98533 WP_000068176.1.98548 WP_000068176.1.98552 WP_000068176.1.98559 WP_000068176.1.98585 WP_000068176.1.98586 WP_000068176.1.986 WP_000068176.1.98609 WP_000068176.1.98655 WP_000068176.1.98659 WP_000068176.1.98667 WP_000068176.1.98703 WP_000068176.1.98706 WP_000068176.1.98710 WP_000068176.1.9872 WP_000068176.1.98723 WP_000068176.1.98730 WP_000068176.1.98734 WP_000068176.1.98741 WP_000068176.1.98750 WP_000068176.1.98767 WP_000068176.1.98786 WP_000068176.1.98797 WP_000068176.1.98805 WP_000068176.1.98807 WP_000068176.1.98821 WP_000068176.1.98825 WP_000068176.1.98837 WP_000068176.1.98842 WP_000068176.1.98858 WP_000068176.1.98865 WP_000068176.1.98874 WP_000068176.1.98880 WP_000068176.1.98883 WP_000068176.1.98912 WP_000068176.1.98924 WP_000068176.1.98967 WP_000068176.1.98981 WP_000068176.1.99009 WP_000068176.1.99025 WP_000068176.1.99027 WP_000068176.1.9903 WP_000068176.1.99081 WP_000068176.1.99090 WP_000068176.1.991 WP_000068176.1.9910 WP_000068176.1.9912 WP_000068176.1.99136 WP_000068176.1.99155 WP_000068176.1.99171 WP_000068176.1.99174 WP_000068176.1.99183 WP_000068176.1.99195 WP_000068176.1.99207 WP_000068176.1.99217 WP_000068176.1.99228 WP_000068176.1.99237 WP_000068176.1.99249 WP_000068176.1.99262 WP_000068176.1.99280 WP_000068176.1.99283 WP_000068176.1.99308 WP_000068176.1.99311 WP_000068176.1.99331 WP_000068176.1.99359 WP_000068176.1.9936 WP_000068176.1.99394 WP_000068176.1.99405 WP_000068176.1.99414 WP_000068176.1.99418 WP_000068176.1.99430 WP_000068176.1.99459 WP_000068176.1.99492 WP_000068176.1.99494 WP_000068176.1.99509 WP_000068176.1.99519 WP_000068176.1.99523 WP_000068176.1.99524 WP_000068176.1.99525 WP_000068176.1.99536 WP_000068176.1.99538 WP_000068176.1.99564 WP_000068176.1.99569 WP_000068176.1.9960 WP_000068176.1.99631 WP_000068176.1.99638 WP_000068176.1.9965 WP_000068176.1.99683 WP_000068176.1.99686 WP_000068176.1.99688 WP_000068176.1.99700 WP_000068176.1.99714 WP_000068176.1.9974 WP_000068176.1.99759 WP_000068176.1.99768 WP_000068176.1.99777 WP_000068176.1.99802 WP_000068176.1.99830 WP_000068176.1.99849 WP_000068176.1.9985 WP_000068176.1.99850 WP_000068176.1.99859 WP_000068176.1.99860 WP_000068176.1.99862 WP_000068176.1.9987 WP_000068176.1.99884 WP_000068176.1.99888 WP_000068176.1.99901 WP_000068176.1.99926 WP_000068176.1.99934 WP_000068176.1.99950 WP_000068176.1.99954 WP_000068176.1.99955 WP_000068176.1.99956 WP_000068176.1.99963 WP_000068176.1.99979 WP_000068176.1.99984 WP_000068176.1.99985 WP_000068176.1.99999 YP_499590.1.76163 gi|379020801|ref|YP_005297463.1| gi|386728774|ref|YP_006195157.1| gi|404478431|ref|YP_006709861.1| gi|545634506|ref|YP_008585076.1| gi|49485932|ref|YP_043153.1| gi|384549855|ref|YP_005739107.1| gi|479329006|ref|YP_007868065.1| gi|384547280|ref|YP_005736533.1| gi|384869627|ref|YP_005752341.1| gi|151221172|ref|YP_001331994.1| gi|87159954|ref|YP_493692.1| 158878.SAV1094 158879.SA0944 196620.MW0977 282458.SAR1068 282459.SAS1029 359786.SaurJH9_1154 359787.SaurJH1_1176 418127.SAHV_1086 426430.NWMN_0960 451515.SAUSA300_0994 451516.USA300HOU_1037 681288.SAAV_1059 93061.SAOUHSC_01041 gi|387780207|ref|YP_005755005.1| gi|384861689|ref|YP_005744409.1| gi|385781322|ref|YP_005757493.1| gi|545637433|ref|YP_008587609.1| gi|537460764|ref|YP_008491204.1| gi|387150236|ref|YP_005741800.1| gi|148267587|ref|YP_001246530.1| gi|514065948|ref|YP_008127868.1| gi|15926679|ref|NP_374212.1| gi|379014287|ref|YP_005290523.1| gi|88194793|ref|YP_499590.1| gi|156979417|ref|YP_001441676.1| gi|521211821|ref|YP_008168167.1| gi|21282706|ref|NP_645794.1| gi|554643827|ref|YP_008715618.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]