SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|387780609|ref|YP_005755407.1| from Staphylococcus aureus subsp. aureus LGA251

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|387780609|ref|YP_005755407.1|
Domain Number 1 Region: 2-204
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 9.64e-70
Family Branched-chain alpha-keto acid dehydrogenase Pyr module 0.00000173
Further Details:      
 
Domain Number 2 Region: 189-325
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 1.19e-39
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|387780609|ref|YP_005755407.1|
Sequence length 327
Comment 2-oxoisovalerate dehydrogenase subunit beta [Staphylococcus aureus subsp. aureus LGA251]
Sequence
MAKLSYLEAIRQAQDLALQQNKDVFILGEDVGKKGGVFGTTQGLQQQYGEDRVIDTPLAE
SNIVGTAIGAAMVGKRPIAEIQFADFILPATNQIISEAAKMRYRSNNEWQCPLTIRAPFG
GGVHGGLYHSQSIESIFASSPGLTIVIPSTPYDAKGLLLSSIESNDPVLYFEHKKAYRFL
KEEVPEEYYTVPLGKADVKREGEDLTVFCYGLMVNYCLQAADILAADGINVEVVDLRTVY
PLDKETIIDRAKHTGKVLLVTEDNLEGSIMSEVSAIIAEHCLFELDAPIMRLAAPDVPSM
PFSPVLENEIMMNPEKILNKMRELAEF
Download sequence
Identical sequences A0A0D1FJU3 A0A1D4SGC0
gi|387780609|ref|YP_005755407.1| gi|545637855|ref|YP_008588031.1| gi|384550344|ref|YP_005739596.1| gi|545634996|ref|YP_008585566.1| WP_001096637.1.100084 WP_001096637.1.100668 WP_001096637.1.10085 WP_001096637.1.102064 WP_001096637.1.10306 WP_001096637.1.1032 WP_001096637.1.1097 WP_001096637.1.11067 WP_001096637.1.11463 WP_001096637.1.11494 WP_001096637.1.11828 WP_001096637.1.12194 WP_001096637.1.12272 WP_001096637.1.12668 WP_001096637.1.13228 WP_001096637.1.13598 WP_001096637.1.13679 WP_001096637.1.13680 WP_001096637.1.13733 WP_001096637.1.13787 WP_001096637.1.14010 WP_001096637.1.14281 WP_001096637.1.14666 WP_001096637.1.14782 WP_001096637.1.15939 WP_001096637.1.16986 WP_001096637.1.17156 WP_001096637.1.18205 WP_001096637.1.185 WP_001096637.1.18590 WP_001096637.1.19259 WP_001096637.1.20177 WP_001096637.1.20500 WP_001096637.1.21458 WP_001096637.1.22307 WP_001096637.1.22547 WP_001096637.1.22714 WP_001096637.1.22808 WP_001096637.1.23194 WP_001096637.1.23431 WP_001096637.1.23617 WP_001096637.1.23710 WP_001096637.1.24681 WP_001096637.1.24918 WP_001096637.1.2544 WP_001096637.1.25955 WP_001096637.1.26306 WP_001096637.1.26555 WP_001096637.1.26713 WP_001096637.1.26726 WP_001096637.1.27199 WP_001096637.1.27834 WP_001096637.1.28081 WP_001096637.1.28426 WP_001096637.1.28672 WP_001096637.1.28874 WP_001096637.1.29445 WP_001096637.1.3029 WP_001096637.1.31202 WP_001096637.1.31701 WP_001096637.1.32215 WP_001096637.1.32348 WP_001096637.1.32517 WP_001096637.1.32584 WP_001096637.1.32588 WP_001096637.1.3293 WP_001096637.1.33610 WP_001096637.1.34089 WP_001096637.1.34249 WP_001096637.1.34371 WP_001096637.1.34970 WP_001096637.1.35746 WP_001096637.1.36211 WP_001096637.1.36952 WP_001096637.1.37053 WP_001096637.1.37408 WP_001096637.1.3784 WP_001096637.1.38212 WP_001096637.1.3850 WP_001096637.1.38637 WP_001096637.1.38658 WP_001096637.1.39020 WP_001096637.1.39839 WP_001096637.1.39918 WP_001096637.1.40794 WP_001096637.1.41411 WP_001096637.1.41448 WP_001096637.1.41726 WP_001096637.1.41770 WP_001096637.1.42575 WP_001096637.1.42667 WP_001096637.1.43225 WP_001096637.1.43573 WP_001096637.1.4380 WP_001096637.1.43800 WP_001096637.1.44903 WP_001096637.1.45131 WP_001096637.1.45218 WP_001096637.1.45586 WP_001096637.1.46082 WP_001096637.1.46418 WP_001096637.1.47353 WP_001096637.1.47561 WP_001096637.1.48199 WP_001096637.1.48212 WP_001096637.1.48556 WP_001096637.1.48655 WP_001096637.1.49143 WP_001096637.1.49152 WP_001096637.1.49530 WP_001096637.1.4984 WP_001096637.1.49921 WP_001096637.1.50377 WP_001096637.1.51465 WP_001096637.1.51571 WP_001096637.1.51672 WP_001096637.1.52423 WP_001096637.1.52464 WP_001096637.1.52751 WP_001096637.1.52865 WP_001096637.1.52886 WP_001096637.1.5323 WP_001096637.1.53352 WP_001096637.1.53433 WP_001096637.1.53488 WP_001096637.1.53503 WP_001096637.1.54373 WP_001096637.1.54728 WP_001096637.1.55353 WP_001096637.1.5536 WP_001096637.1.55657 WP_001096637.1.55874 WP_001096637.1.55960 WP_001096637.1.56530 WP_001096637.1.57389 WP_001096637.1.57459 WP_001096637.1.58212 WP_001096637.1.58497 WP_001096637.1.59062 WP_001096637.1.5938 WP_001096637.1.59380 WP_001096637.1.59547 WP_001096637.1.59819 WP_001096637.1.59921 WP_001096637.1.59945 WP_001096637.1.60101 WP_001096637.1.60917 WP_001096637.1.61353 WP_001096637.1.62084 WP_001096637.1.62085 WP_001096637.1.62318 WP_001096637.1.6234 WP_001096637.1.62608 WP_001096637.1.62860 WP_001096637.1.63131 WP_001096637.1.63170 WP_001096637.1.63874 WP_001096637.1.63878 WP_001096637.1.63895 WP_001096637.1.64279 WP_001096637.1.64549 WP_001096637.1.65203 WP_001096637.1.6531 WP_001096637.1.66056 WP_001096637.1.66287 WP_001096637.1.66726 WP_001096637.1.67296 WP_001096637.1.67712 WP_001096637.1.67762 WP_001096637.1.68505 WP_001096637.1.69232 WP_001096637.1.69361 WP_001096637.1.69434 WP_001096637.1.70611 WP_001096637.1.71236 WP_001096637.1.71572 WP_001096637.1.71575 WP_001096637.1.73693 WP_001096637.1.74088 WP_001096637.1.74242 WP_001096637.1.74645 WP_001096637.1.74693 WP_001096637.1.74978 WP_001096637.1.75379 WP_001096637.1.75851 WP_001096637.1.75956 WP_001096637.1.76411 WP_001096637.1.76528 WP_001096637.1.76878 WP_001096637.1.77020 WP_001096637.1.77256 WP_001096637.1.77763 WP_001096637.1.78513 WP_001096637.1.78708 WP_001096637.1.78731 WP_001096637.1.78785 WP_001096637.1.79341 WP_001096637.1.79855 WP_001096637.1.80414 WP_001096637.1.80734 WP_001096637.1.809 WP_001096637.1.81065 WP_001096637.1.82441 WP_001096637.1.82775 WP_001096637.1.8310 WP_001096637.1.83468 WP_001096637.1.85440 WP_001096637.1.8572 WP_001096637.1.8576 WP_001096637.1.8609 WP_001096637.1.86526 WP_001096637.1.86910 WP_001096637.1.87264 WP_001096637.1.87601 WP_001096637.1.87948 WP_001096637.1.88583 WP_001096637.1.89070 WP_001096637.1.89235 WP_001096637.1.89933 WP_001096637.1.90112 WP_001096637.1.90232 WP_001096637.1.90307 WP_001096637.1.90432 WP_001096637.1.91087 WP_001096637.1.91252 WP_001096637.1.91365 WP_001096637.1.92340 WP_001096637.1.92398 WP_001096637.1.92602 WP_001096637.1.92778 WP_001096637.1.92848 WP_001096637.1.93010 WP_001096637.1.93141 WP_001096637.1.93207 WP_001096637.1.93231 WP_001096637.1.93235 WP_001096637.1.93310 WP_001096637.1.93613 WP_001096637.1.94423 WP_001096637.1.96280 WP_001096637.1.96628 WP_001096637.1.96663 WP_001096637.1.96892 WP_001096637.1.96928 WP_001096637.1.97234 WP_001096637.1.99700 WP_001096637.1.99901 WP_001096637.1.99934 gi|379021299|ref|YP_005297961.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]