SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|336252322|ref|YP_004595429.1| from Halopiger xanaduensis SH-6

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|336252322|ref|YP_004595429.1|
Domain Number 1 Region: 121-197,327-428
Classification Level Classification E-value
Superfamily SGNH hydrolase 0.000000172
Family Acetylhydrolase 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|336252322|ref|YP_004595429.1|
Sequence length 430
Comment hypothetical protein Halxa_0914 [Halopiger xanaduensis SH-6]
Sequence
MPGKSTWGPFLYHRIRMFPFLALAVVTVGIVVVLEVVSYRALERIPSVATEEFPEIDREL
LGKFSSFDPELGWVPQPDQEKQKDTGDHLPGEELRTVVTYSTDEYGSRVCPAKDRDTDAD
VTVSTYGDSYCFCREVNNDETFQHYMAQELDTHVANYGGGNYGLDQALMRLKRQYPEEPT
DYVFVVVTASSIARILSVWKHYQEFGNILAVKPRYVLEDGELERIDSPVDEKEDLLDLES
KADFLREYDFHYDHWFKPHYATRPYTTDFLDDAEKVRYALYEAGIEIEKRLERPIPGIDF
DQAQTQSMLRMEQARVRYHERLFETHEYLFDALIAEFVDYAEEQGFTPVFAMVQQLRYAK
YEAEHGPIYGDLLDRLDERYDDLETVDMVEHLSPDDGDVESLYVERGEGGHYSPETNREI
AKVLADVVES
Download sequence
Identical sequences F8D8C7
gi|336252322|ref|YP_004595429.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]