SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|336252622|ref|YP_004595729.1| from Halopiger xanaduensis SH-6

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|336252622|ref|YP_004595729.1|
Domain Number 1 Region: 1-183
Classification Level Classification E-value
Superfamily Ligand-binding domain in the NO signalling and Golgi transport 3.61e-20
Family H-NOX domain 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|336252622|ref|YP_004595729.1|
Sequence length 187
Comment Heme NO binding domain-containing protein [Halopiger xanaduensis SH-6]
Sequence
MHGIVHKTLETYVVDRTDEETWERVVDRADLEPRLYLQVSHYDDREIDAVLETLTELAPQ
DRRTIERGFGRTLAPELLSTFNAHIRTDRDVLELLANLEQTVREIDTATEKASLPDISSR
PDGNEVTVTYDTHRETTYCGLAHGVLEGLLTAFDADGTVTEQACGREDEGEDDVDACRFL
VTVEDEE
Download sequence
Identical sequences F8DB74
gi|336252622|ref|YP_004595729.1| WP_013878749.1.76661

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]